Did you know that you can buy products from over 140 different suppliers from us?

ATPase, H+/K+ Exchanging, beta Polypeptide (ATP4b) (Middle Region) antibody

Details for Product No. ABIN405642
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ATP6B, AV080843, S76401S1
Epitope
Middle Region
(8), (7), (3), (3), (2), (1), (1), (1), (1), (1)
Reactivity
Rabbit, Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Pig (Porcine), Xenopus laevis, Zebrafish (Danio rerio), Human, Chicken
(40), (26), (22), (18), (18), (18), (17), (1), (1)
Host
Rabbit
(38), (7)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(31), (24), (14), (13), (4), (4), (3), (3), (1), (1), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN405642
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human ATP4B
Sequence QVKYYPPNGTFSLHYFPYYGKKAQPHYSNPLVAAKLLNIP RNAEVAIVCK
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rabbit : 100 %, Rat : 100 %, Chicken : 90 %
Characteristics This is a rabbit polyclonal antibody against ATP4B. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ATP4B
Background ATP4B belongs to a family of P-type cation-transporting ATPases. The gastric H+, K+-ATPase is a heterodimer consisting of a high molecular weight catalytic alpha subunit and a smaller but heavily glycosylated beta subunit. This enzyme is a proton pump that catalyzes the hydrolysis of ATP coupled with the exchange of H(+) and K(+) ions across the plasma membrane. It is also responsible for gastric acid secretion. This gene encodes the beta subunit of the gastric H+, K+-ATPase.The protein encoded by this gene belongs to a family of P-type cation-transporting ATPases. The gastric H+, K+-ATPase is a heterodimer consisting of a high molecular weight catalytic alpha subunit and a smaller but heavily glycosylated beta subunit. This enzyme is a proton pump that catalyzes the hydrolysis of ATP coupled with the exchange of H(+) and K(+) ions across the plasma membrane. It is also responsible for gastric acid secretion. This gene encodes the beta subunit of the gastric H+, K+-ATPase.
Molecular Weight 33 kDa
Gene ID 496
NCBI Accession NM_000705, NP_000696
UniProt P51164
Research Area Enzymes, Metabolism
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 291 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Oh, Yang, Hahn et al.: "Transcriptome analysis of human gastric cancer." in: Mammalian genome : official journal of the International Mammalian Genome Society, Vol. 16, Issue 12, pp. 942-54, 2005 (PubMed).

Validation Images
back to top