Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN405656

Ubiquinol-Cytochrome C Reductase, Complex III Subunit X (UQCR10) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms HSPC051, HSPC151, QCR9, UCCR7.2, UCRC, 1110020P15Rik, AA960494, Ucrc, qcr9, ucrc
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Rat (Rattus), Mouse (Murine), Cow (Bovine), Dog (Canine), Pig (Porcine), Xenopus laevis, Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN405656
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-UCRC antibody: synthetic peptide directed towards the middle region of human UCRC
Sequence LFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLW KHIKHKYENK
Predicted Reactivity Rat :100%,   Human :100%,   Mouse :92%,   Bovine :92%,   Dog :85%,   Pig :85%,   African clawed frog :84%,   Western clawed frog :84%,   Chicken :78%,  
Characteristics This is a rabbit polyclonal antibody against UCRC. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name UCRC
Background UCRC is a subunit of mitochondrial complex III (ubiquinol-cytochrome c reductase, EC 1.10.2.2), which forms the middle segment of the respiratory chain of the inner mitochondrial membrane.UCRC is a subunit of mitochondrial complex III (ubiquinol-cytochrome c reductase, EC 1.10.2.2), which forms the middle segment of the respiratory chain of the inner mitochondrial membrane (Schagger et al., 1995 [PubMed 8592474]).
Molecular Weight 7kDa
Gene ID 29796
NCBI Accession NP_037519, NM_013387
UniProt Q9UDW1
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-UCRC antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Guzy, Hoyos, Robin et al.: "Mitochondrial complex III is required for hypoxia-induced ROS production and cellular oxygen sensing." in: Cell metabolism, Vol. 1, Issue 6, pp. 401-8, 2005 (PubMed).

Alternatives for antigen "Ubiquinol-Cytochrome C Reductase, Complex III Subunit X (UQCR10)", type "Antibodies"
Hosts (2), (1)
Reactivities (3)
Applications (2), (2), (1)
Epitopes (1), (1)
Beacon