Ubiquinol-Cytochrome C Reductase, Complex III Subunit X (UQCR10) (Middle Region) antibody

Details for Product No. ABIN405656
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms HSPC051, HSPC151, QCR9, UCCR7.2, UCRC, 1110020P15Rik, AA960494, Ucrc, qcr9, ucrc
Epitope
Middle Region
(1), (1)
Reactivity
Rat (Rattus), Mouse (Murine), Cow (Bovine), Dog (Canine), Pig (Porcine), Xenopus laevis, Human, Chicken
(4), (1), (1)
Host
Rabbit
(3), (1)
Clonality
Polyclonal
Application
Western Blotting (WB)
(3), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN405656
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human UCRC
Sequence LFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLW KHIKHKYENK
Predicted Reactivity Rat :100 %,   Human :100 %,   Mouse :90 %,   Bovine :90 %,   Dog :80 %,   Pig :80 %,   African clawed frog :80 %,   Western clawed frog :80 %,   Chicken :70 %,  
Characteristics This is a rabbit polyclonal antibody against UCRC. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name UCRC
Background UCRC is a subunit of mitochondrial complex III (ubiquinol-cytochrome c reductase, EC 1.10.2.2), which forms the middle segment of the respiratory chain of the inner mitochondrial membrane.UCRC is a subunit of mitochondrial complex III (ubiquinol-cytochrome c reductase, EC 1.10.2.2), which forms the middle segment of the respiratory chain of the inner mitochondrial membrane (Schagger et al., 1995 [PubMed 8592474]).
Molecular Weight 7 kDa
Gene ID 29796
NCBI Accession NM_013387, NP_037519
UniProt Q9UDW1
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 63 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Ubiquinol-Cytochrome C Reductase, Complex III Subunit X (UQCR10) (Middle Region) antibody WB Suggested Anti-UCRC Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: MCF7 cell lysate
Background publications Guzy, Hoyos, Robin et al.: "Mitochondrial complex III is required for hypoxia-induced ROS production and cellular oxygen sensing." in: Cell metabolism, Vol. 1, Issue 6, pp. 401-8, 2005 (PubMed).

Hosts (3), (1)
Reactivities (4), (1), (1)
Applications (3), (1), (1)
Epitopes (1), (1)
back to top