Did you know that you can buy products from over 140 different suppliers from us?

Ectodysplasin A (EDA) (Middle Region) antibody

Details for Product No. ABIN405665
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 0610040D20Rik, 2900052N06Rik, Ed1, c11orf5, mED1, ECTD1, ED1, ED1-A1, ED1-A2, EDA-A1, EDA-A2, EDA1, EDA2, HED, HED1, ODT1, STHAGX1, XHED, XLHED, si:ch73-223d24.5, Eda-A1, Eda-A2, Ta, tabby, RGD1563178
Epitope
Middle Region
(11), (2), (2), (2), (2), (1), (1), (1)
Reactivity
Mouse (Murine), Dog (Canine), Cow (Bovine), Human, Chicken
(54), (34), (34), (30), (18), (12), (1), (1)
Host
Rabbit
(54), (3)
Clonality
Polyclonal
Conjugate
Un-conjugated
(4), (3), (3), (2), (2), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(31), (24), (18), (13), (11), (9), (1), (1)
Pubmed 2 references available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN405665
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human EDA
Sequence HLQGQGSAIQVKNDLSGGVLNDWSRITMNPKVFKLHPRSG ELEVLVDGTY
Predicted Reactivity Bovine : 100 %, Chicken : 100 %, Dog : 100 %, Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rabbit : 100 %, Rat : 100 %
Characteristics This is a rabbit polyclonal antibody against EDA. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name EDA
Background EDA is a type II membrane protein that can be cleaved by furin to produce a secreted form. It belongs to the tumor necrosis factor family, acts as a homotrimer and may be involved in cell-cell signaling during the development of ectodermal organs. Defects in this gene are a cause of ectodermal dysplasia, anhidrotic, which is also known as X-linked hypohidrotic ectodermal dysplasia. Several transcript variants encoding many different isoforms have been found for this gene. The protein encoded by this gene is a type II membrane protein that can be cleaved by furin to produce a secreted form. The encoded protein, which belongs to the tumor necrosis factor family, acts as a homotrimer and may be involved in cell-cell signaling during the development of ectodermal organs. Defects in this gene are a cause of ectodermal dysplasia, anhidrotic, which is also known as X-linked hypohidrotic ectodermal dysplasia. Several transcript variants encoding many different isoforms have been found for this gene.
Molecular Weight 41 kDa
Gene ID 1896
NCBI Accession NM_001005609, NP_001005609
UniProt B7ZLU4
Research Area Lineage Markers
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 389 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Ectodysplasin A (EDA) (Middle Region) antibody WB Suggested Anti-EDA Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate
Product cited in: Zhao, Watt, Battle et al.: "Loss of both GATA4 and GATA6 blocks cardiac myocyte differentiation and results in acardia in mice." in: Developmental biology, Vol. 317, Issue 2, pp. 614-9, 2008 (PubMed).

Background publications Zhao, Hua, Zhao et al.: "Three novel mutations of the EDA gene in Chinese patients with X-linked hypohidrotic ectodermal dysplasia." in: The British journal of dermatology, Vol. 158, Issue 3, pp. 614-7, 2008 (PubMed).

Validation Images
back to top