Ras Homolog Gene Family, Member T1 (RHOT1) (N-Term) antibody

Details for Product No. ABIN405704
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ARHT1, MIRO-1, MIRO1, 2210403N23Rik, AA415293, AF244542, AI834919, Arht1, C430039G08Rik, Miro1, rhot1, zgc:55581, zgc:77063, wu:fd14e11, wu:fi14a05, arht2, miro-2, rasl, miro1, si:dkeyp-97g3.6
Epitope
N-Term
(3), (3), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Zebrafish (Danio rerio), Human, Chicken
(12), (2), (2), (2), (2), (2), (2), (1), (1), (1)
Host
Rabbit
(9), (6)
Clonality
Polyclonal
Application
Western Blotting (WB)
(15), (4), (2), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN405704
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human RHOT1
Sequence EMKPACIKALTRIFKISDQDNDGTLNDAELNFFQRICFNT PLAPQALEDV
Predicted Reactivity Chicken : 100 %, Dog : 100 %, Guinea pig : 100 %, Horse : 100 %, Pig : 100 %, Rabbit : 100 %, Rat : 100 %
Characteristics This is a rabbit polyclonal antibody against RHOT1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name RHOT1
Background RHOT1 is mitochondrial GTPase involved in mitochondrial trafficking. It is probably involved in control of anterograde transport of mitochondria and their subcellular distribution.
Molecular Weight 75 kDa
Gene ID 55288
NCBI Accession NM_001033566, NP_001028738
UniProt Q8IXI2
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 659 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Ras Homolog Gene Family, Member T1 (RHOT1) (N-Term) antibody WB Suggested Anti-RHOT1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 293T cell lysate
Background publications Fransson, Ruusala, Aspenström: "The atypical Rho GTPases Miro-1 and Miro-2 have essential roles in mitochondrial trafficking." in: Biochemical and biophysical research communications, Vol. 344, Issue 2, pp. 500-10, 2006 (PubMed).

Hosts (9), (6)
Reactivities (12), (2), (2), (2), (2), (2), (2), (1), (1), (1)
Applications (15), (4), (2), (1), (1)
Epitopes (3), (3), (1), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top