Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN405704

Ras Homolog Gene Family, Member T1 (RHOT1) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ARHT1, MIRO-1, MIRO1, 2210403N23Rik, AA415293, AF244542, AI834919, Arht1, C430039G08Rik, Miro1, rhot1, zgc:55581, zgc:77063, wu:fd14e11, wu:fi14a05, arht2, miro-2, rasl, miro1, si:dkeyp-97g3.6
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Zebrafish (Danio rerio), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN405704
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-RHOT1 antibody: synthetic peptide directed towards the N terminal of human RHOT1
Sequence EMKPACIKALTRIFKISDQDNDGTLNDAELNFFQRICFNT PLAPQALEDV
Predicted Reactivity Chicken : 100%, Dog : 100%, Guinea pig : 100%, Horse : 100%, Pig : 100%, Rabbit : 100%, Rat : 100%
Characteristics This is a rabbit polyclonal antibody against RHOT1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name RHOT1
Background RHOT1 is mitochondrial GTPase involved in mitochondrial trafficking. It is probably involved in control of anterograde transport of mitochondria and their subcellular distribution.
Molecular Weight 75kDa
Gene ID 55288
NCBI Accession NP_001028738, NM_001033566
UniProt Q8IXI2
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-RHOT1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Fransson, Ruusala, Aspenström: "The atypical Rho GTPases Miro-1 and Miro-2 have essential roles in mitochondrial trafficking." in: Biochemical and biophysical research communications, Vol. 344, Issue 2, pp. 500-10, 2006 (PubMed).

Alternatives for antigen "Ras Homolog Gene Family, Member T1 (RHOT1)", type "Antibodies"
Hosts (11), (6)
Reactivities (14), (2), (2), (2), (2), (2), (2), (1), (1), (1)
Applications (17), (7), (2), (1), (1)
Epitopes (6), (3), (2), (1), (1), (1), (1)
Beacon