Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Down Syndrome Cell Adhesion Molecule (DSCAM) antibody

Antigen

Down Syndrome Cell Adhesion Molecule (DSCAM)
Synonyms Dscam, DSCAM, chd2-42, chd2-52, GB15141, CHD2-42, CHD2-52, 4932410A21Rik, 43Bc, CT39257, Dscam1, FBgn0033159, Neu1, l(2)05518, l(2)43Bc, p270, DmelCG17800, CG17800
Clonality Polyclonal
Host
Alternatives

Rabbit
Reactivity
Alternatives

Human, Mouse (Murine), Rat (Rattus), Xenopus laevis
Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN405723
Quantity 50 µg
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

anti-Down Syndrome Cell Adhesion Molecule (DSCAM) antibody

Additional Information
Application Details Publications Images Alternatives back to top

Alternative name DSCAM
Gene ID DSCAM
UniProt O60469
Immunogen The immunogen for anti-DSCAM antibody: synthetic peptide directed towards the middle region of human DSCAM
Sequence MRVCNSAGCAEKQANFATLNYDGSTIPPLIKSVVQNEEGL TTNEGLKMLV
Cross-Reactivity Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-DSCAM antibody concentration is 1 mg/ml.
Description DSCAM is a cell adhesion molecule that can mediate cation-independent homophilic binding activity. DSCAM could be involved in nervous system development.
Characteristics Antigen Size: 2012 amino acids
Molecular Weight 220kDa

Application Details
Publications Images Alternatives back to top

Application Notes WB Suggested Anti-DSCAM Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: HepG2 cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications
Application Details Images Alternatives back to top

Product Uhl, Liu, Drgon et al.: "Molecular genetics of successful smoking cessation: convergent genome-wide association study results." in: Archives of general psychiatry, Vol. 65, Issue 6, pp. 683-93, 2008 (PubMed).

Alternatives
Application Details Publications Images back to top

Alternatives for antigen "Down Syndrome Cell Adhesion Molecule (DSCAM)", type "Antibodies"
Hosts Rabbit (20), Goat (4), Mouse (3)
Reactivities Human (23), Mouse (Murine) (20), Chicken (19), Dog (Canine) (19), Rat (Rattus) (19), Cow (Bovine) (18), Horse (Equine) (18), Sheep (Ovine) (18)
Applications Flow Cytometry (FACS) (15), Immunofluorescence (IF) (15), ELISA (8), Western Blotting (WB) (8), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (4), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunocytochemistry (ICC) (2), Immunoelectron Microscopy (IEM) (1), Immunohistochemistry (IHC) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE-Cy3 (1), PE-Cy5 (1), PE-Cy5.5 (1), PE-Cy7 (1)
Epitopes AA 301-400 (18), Internal Region (2), AA 18-1595 (1)