Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN405767

Chromosome 21 Open Reading Frame 2 (C21orf2) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms YF5/A2, MGC75902
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Rat (Rattus), Mouse (Murine), Cow (Bovine), Xenopus laevis, Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN405767
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-C21orf2 antibody: synthetic peptide directed towards the N terminal of human C21orf2
Sequence KLTRKMVLTRAKASELHSVRKLNCWGSRLTDISICQEMPS LEVITLSVNS
Predicted Reactivity Human : 100%, African clawed frog : 78%
Characteristics This is a rabbit polyclonal antibody against C21orf2. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name C21orf2
Background The function of the C21orf2 protein remains unknown.
Molecular Weight 28kDa
Gene ID 755
NCBI Accession NP_004919, NM_004928
UniProt O43822
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-C21orf2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Oh, Yang, Hahn et al.: "Transcriptome analysis of human gastric cancer." in: Mammalian genome : official journal of the International Mammalian Genome Society, Vol. 16, Issue 12, pp. 942-54, 2005 (PubMed).

Alternatives for antigen "Chromosome 21 Open Reading Frame 2 (C21orf2)", type "Antibodies"
Hosts (19), (3)
Reactivities (21), (12), (12)
Applications (10), (9), (7), (3), (1), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (3), (2), (2), (1), (1)
Beacon