Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN405773

Chromosome 21 Open Reading Frame 59 (C21orf59) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms C21orf48, C21orf59, MGC83493, RA_m005_jsm24C07r, C3H21orf59
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Rabbit, Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN405773
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-C21orf59 antibody: synthetic peptide directed towards the N terminal of human C21orf59
Sequence VLLHVKRGDESQFLLQAPGSTELEELTVQVARVYNGRLKV QRLCSEMEEL
Predicted Reactivity Human : 100%
Characteristics This is a rabbit polyclonal antibody against C21orf59. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name C21orf59
Background The function of the C21orf59 protein remains unknown.
Molecular Weight 33kDa
Gene ID 56683
NCBI Accession NP_067077, NM_021254
UniProt P57076
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-C21orf59 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Denoeud, Kapranov, Ucla et al.: "Prominent use of distal 5' transcription start sites and discovery of a large number of additional exons in ENCODE regions." in: Genome research, Vol. 17, Issue 6, pp. 746-59, 2007 (PubMed).

Alternatives for antigen "Chromosome 21 Open Reading Frame 59 (C21orf59)", type "Antibodies"
Hosts (15), (12)
Reactivities (26), (12), (12), (12), (12)
Applications (18), (10), (10), (6), (5), (3), (2)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (3), (2), (1), (1)
Beacon