Chromosome 21 Open Reading Frame 59 (C21orf59) (N-Term) antibody

Details for Product No. ABIN405773
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms C21orf48, C21orf59, MGC83493, RA_m005_jsm24C07r, C3H21orf59
Epitope
N-Term
(3), (2), (1)
Reactivity
Rabbit, Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human
(25), (12), (12), (12), (12)
Host
Rabbit
(14), (12)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(17), (10), (10), (6), (3), (3), (2)
Pubmed 1 reference available
Catalog no. ABIN405773
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human C21orf59
Sequence VLLHVKRGDESQFLLQAPGSTELEELTVQVARVYNGRLKV QRLCSEMEEL
Predicted Reactivity Human : 100 %
Characteristics This is a rabbit polyclonal antibody against C21orf59. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name C21orf59
Background The function of the C21orf59 protein remains unknown.
Molecular Weight 33 kDa
Gene ID 56683
NCBI Accession NM_021254, NP_067077
UniProt P57076
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 290 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Chromosome 21 Open Reading Frame 59 (C21orf59) (N-Term) antibody WB Suggested Anti-C21orf59 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate
anti-Chromosome 21 Open Reading Frame 59 (C21orf59) (N-Term) antibody (2) anti-Chromosome 21 Open Reading Frame 59 (C21orf59) (N-Term) antibody (Image 2)
Background publications Denoeud, Kapranov, Ucla et al.: "Prominent use of distal 5' transcription start sites and discovery of a large number of additional exons in ENCODE regions." in: Genome research, Vol. 17, Issue 6, pp. 746-59, 2007 (PubMed).

Hosts (14), (12)
Reactivities (25), (12), (12), (12), (12)
Applications (17), (10), (10), (6), (3), (3), (2)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (3), (2), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top