Leber Congenital Amaurosis 5-Like (LCA5L) (Middle Region) antibody

Details for Product No. ABIN405776
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms C21orf13, Lcca5l, 4921526F01Rik
Epitope
Middle Region
(2), (2), (1), (1)
Reactivity
Cow (Bovine), Dog (Canine), Human
(17), (13), (12), (12), (12)
Host
Rabbit
(19)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(10), (10), (5), (4)
Pubmed 1 reference available
Catalog no. ABIN405776
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human C21orf13
Sequence GSEEPLQSKESHPLPPSQASTSHAFGDSKVTVVNSIKPSS PTEGKRKIII
Predicted Reactivity Olive baboon :100 %,   Dusky titi monkey :100 %,   Crab-eating macaque :100 %,   Human :100 %,   Bovine :80 %,   Dog :80 %,  
Characteristics This is a rabbit polyclonal antibody against C21orf13. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name C21orf13
Background The function of the C21orf13 protein remains unknown.
Molecular Weight 76 kDa
Gene ID 150082
NCBI Accession NM_152505, NP_689718
UniProt O95447
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 670 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Leber Congenital Amaurosis 5-Like (LCA5L) (Middle Region) antibody WB Suggested Anti-C21orf13 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: MCF7 cell lysate
Background publications den Hollander, Koenekoop, Mohamed et al.: "Mutations in LCA5, encoding the ciliary protein lebercilin, cause Leber congenital amaurosis." in: Nature genetics, Vol. 39, Issue 7, pp. 889-95, 2007 (PubMed).

Hosts (19)
Reactivities (17), (13), (12), (12), (12)
Applications (10), (10), (5), (4)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (2), (2), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top