Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN405776

Leber Congenital Amaurosis 5-Like (LCA5L) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms C21orf13, Lcca5l, 4921526F01Rik
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Cow (Bovine), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN405776
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-C21orf13 antibody: synthetic peptide directed towards the middle region of human C21orf13
Sequence GSEEPLQSKESHPLPPSQASTSHAFGDSKVTVVNSIKPSS PTEGKRKIII
Predicted Reactivity Olive baboon :100%,   Dusky titi monkey :100%,   Crab-eating macaque :100%,   Human :100%,   Bovine :85%,   Dog :85%,  
Characteristics This is a rabbit polyclonal antibody against C21orf13. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name C21orf13
Background The function of the C21orf13 protein remains unknown.
Molecular Weight 76kDa
Gene ID 150082
NCBI Accession NP_689718, NM_152505
UniProt O95447
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-C21orf13 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications den Hollander, Koenekoop, Mohamed et al.: "Mutations in LCA5, encoding the ciliary protein lebercilin, cause Leber congenital amaurosis." in: Nature genetics, Vol. 39, Issue 7, pp. 889-95, 2007 (PubMed).

Alternatives for antigen "Leber Congenital Amaurosis 5-Like (LCA5L)", type "Antibodies"
Hosts (21)
Reactivities (19), (16), (12), (12), (12)
Applications (12), (10), (6), (5), (3)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (4), (2), (2), (2), (1)
Beacon