Did you know that you can buy products from over 140 different suppliers from us?

Mitochondrial Ribosomal Protein L39 (MRPL39) (N-Term) antibody

Details for Product No. ABIN405805
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms C21orf92, L39mt, MRP-L5, MRPL5, PRED22, PRED66, RPML5, C21orf8, ORF22, Rpml5, CG17166, Dmel\\CG17166, mRpL5
Epitope
N-Term
(8), (7), (1), (1)
Reactivity
Mouse (Murine), Cow (Bovine), Xenopus laevis, Human
(32), (12), (12)
Host
Rabbit
(33)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(24), (17), (10), (8), (4)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN405805
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human MRPL39
Sequence TELTEMRNDLFNKEKARQLSLTPRTEKIEVKHVGKTDPGT VFVMNKNIST
Predicted Reactivity Human : 100 %, Bovine : 90 %, Dog : 90 %, Guinea pig : 90 %, Horse : 90 %, Mouse : 90 %, Pig : 90 %, Rabbit : 90 %, Chicken : 70 %
Characteristics This is a rabbit polyclonal antibody against MRPL39. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name MRPL39
Background Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. MRPL39 is a 39S subunit protein. Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75 % protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein. Two transcript variants encoding distinct isoforms have been described. A pseudogene corresponding to this gene is found on chromosome 5q.
Molecular Weight 39 kDa
Gene ID 54148
NCBI Accession NM_017446, NP_059142
UniProt Q9NYK5
Research Area Chromatin and Nuclear Signaling, DNA/RNA
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 338 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Zhang, Gerstein: "Identification and characterization of over 100 mitochondrial ribosomal protein pseudogenes in the human genome." in: Genomics, Vol. 81, Issue 5, pp. 468-80, 2003 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN405805
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top