Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN405805

Mitochondrial Ribosomal Protein L39 (MRPL39) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms C21orf92, L39mt, MRP-L5, MRPL5, PRED22, PRED66, RPML5, C21orf8, ORF22, Rpml5, CG17166, Dmel\\CG17166, mRpL5
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Cow (Bovine), Xenopus laevis, Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN405805
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-MRPL39 antibody: synthetic peptide directed towards the N terminal of human MRPL39
Sequence TELTEMRNDLFNKEKARQLSLTPRTEKIEVKHVGKTDPGT VFVMNKNIST
Predicted Reactivity Human : 100%, Bovine : 92%, Dog : 92%, Guinea pig : 92%, Horse : 92%, Mouse : 92%, Pig : 92%, Rabbit : 92%, Chicken : 78%
Characteristics This is a rabbit polyclonal antibody against MRPL39. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name MRPL39
Background Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. MRPL39 is a 39S subunit protein. Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein. Two transcript variants encoding distinct isoforms have been described. A pseudogene corresponding to this gene is found on chromosome 5q.
Molecular Weight 39kDa
Gene ID 54148
NCBI Accession NP_059142, NM_017446
UniProt Q9NYK5
Research Area Chromatin and Nuclear Signaling, DNA/RNA
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-MRPL39 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Zhang, Gerstein: "Identification and characterization of over 100 mitochondrial ribosomal protein pseudogenes in the human genome." in: Genomics, Vol. 81, Issue 5, pp. 468-80, 2003 (PubMed).

Alternatives for antigen "Mitochondrial Ribosomal Protein L39 (MRPL39)", type "Antibodies"
Hosts (26)
Reactivities (25), (12), (12)
Applications (17), (10), (9), (5), (4)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (4), (2), (1), (1)
Beacon