Acyl-CoA Synthetase Long-Chain Family Member 3 (Acsl3) (N-Term) antibody

Details for Product No. ABIN405824
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ACS3, FACL3, PRO2194, Acs3, Facl3, C85929, Pro2194, 2610510B12Rik, ACSL3, acsl3, fa07a08, im:7155129, si:dkey-20f20.5, wu:fa07a08, wu:fb34c03, si:dkeyp-109h9.2
Epitope
N-Term
(12), (9), (8), (3), (2), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Pig (Porcine), Human
(33), (2), (2)
Host
Rabbit
(32), (2)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (2), (2), (2)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(32), (22), (7), (6), (3), (3), (2)
Pubmed 1 reference available
Catalog no. ABIN405824
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human ACSL3
Sequence LDGLASVLYPGCDTLDKVFTYAKNKFKNKRLLGTREVLNE EDEVQPNGKI
Predicted Reactivity Human : 100 %, Mouse : 100 %, Bovine : 90 %, Horse : 90 %, Rabbit : 90 %, Rat : 90 %, Pig : 80 %
Characteristics This is a rabbit polyclonal antibody against ACSL3. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ACSL3
Background ACSL3 is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme is highly expressed in brain, and preferentially utilizes myristate, arachidonate, and eicosapentaenoate as substrates. The protein encoded by this gene is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme is highly expressed in brain, and preferentially utilizes myristate, arachidonate, and eicosapentaenoate as substrates. The amino acid sequence of this isozyme is 92 % identical to that of rat homolog. Two transcript variants encoding the same protein have been found for this gene.
Molecular Weight 80 kDa
Gene ID 2181
NCBI Accession NM_004457, NP_004448
UniProt O95573
Research Area Cardiovascular, Fatty Acids, Metabolism
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 720 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Acyl-CoA Synthetase Long-Chain Family Member 3 (Acsl3) (N-Term) antibody WB Suggested Anti-ACSL3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 293T cell lysate
Background publications Yao, Ye: "Long chain acyl-CoA synthetase 3-mediated phosphatidylcholine synthesis is required for assembly of very low density lipoproteins in human hepatoma Huh7 cells." in: The Journal of biological chemistry, Vol. 283, Issue 2, pp. 849-54, 2008 (PubMed).

Hosts (32), (2)
Reactivities (33), (2), (2)
Applications (32), (22), (7), (6), (3), (3), (2)
Conjugates (2), (2), (2), (2), (2), (2)
Epitopes (12), (9), (8), (3), (2), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top