Wingless-Type MMTV Integration Site Family, Member 6 (WNT6) antibody

Antigen: Wingless-Type MMTV Integration Site Family, Member 6 (WNT6)

Synonyms: WNT6, LOC561831, Wnt6

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human, Mouse (Murine), Rat (Rattus)

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Catalog no.: ABIN405845

Additional Information

Alternative name: WNT6

Gene ID: WNT6

UniProt: Q9Y6F9

Immunogen: The immunogen for anti-WNT6 antibody: synthetic peptide directed towards the middle region of human WNT6

Sequence: ERFHGASRVMGTNDGKALLPAVRTLKPPGRADLLYAADSP DFCAPNRRTG

Cross-Reactivity: Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-WNT6 antibody concentration is 1 mg/ml.

Description: The WNT family consists of several secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. WNT6 is overexpressed in cervical cancer cell line and strongly coexpressed with another family member, WNT10A, in colorectal cancer cell line. The WNT6 protein overexpression may play key roles in carcinogenesis. The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene is a member of the WNT gene family. It is overexpressed in cervical cancer cell line and strongly coexpressed with another family member, WNT10A, in colorectal cancer cell line. The gene overexpression may play key roles in carcinogenesis. This gene and the WNT10A gene are clustered in the chromosome 2q35 region. The protein encoded by this gene is 97% identical to the mouse Wnt6 protein at the amino acid level.

Characteristics: Antigen Size: 365 amino acids

Molecular Weight: 37kDa

Application Details

Application Notes: WB Suggested Anti-WNT6 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 293T cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-WNT6 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 293T cell lysate

Publications

Product: Adaimy, Chouery, Megarbane et al.: "Mutation in WNT10A is associated with an autosomal recessive ectodermal dysplasia: the odonto-onycho-dermal dysplasia." in: American journal of human genetics, Vol. 81, Issue 4, pp. 821-8, 2007 (PubMed).