Did you know that you can buy products from over 140 different suppliers from us?

Transmembrane Protein 115 (TMEM115) (N-Term) antibody

Details for Product No. ABIN405856
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms PL6, RGD1310540, wu:fc43c03, wu:fd18h12, zgc:114074, C78915, Pl6, Pp6, TMEM115
Epitope
N-Term
(6), (4), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Zebrafish (Danio rerio), Human
(27), (12), (12)
Host
Rabbit
(17), (9), (2)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(16), (12), (10), (3), (3), (2)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN405856
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human TMEM115
Sequence LLSFAVDTGCLAVTPGYLFPPNFWIWTLATHGLMEQHVWD VAISLTTVVV
Predicted Reactivity Dog : 100 %, Mouse : 100 %, Rabbit : 100 %, Rat : 100 %, Zebrafish : 80 %
Characteristics This is a rabbit polyclonal antibody against TMEM115. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name TMEM115
Background The specific function of TMEM115 is not yet known.
Molecular Weight 38 kDa
Gene ID 11070
NCBI Accession NM_007024, NP_008955
UniProt Q12893
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 351 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Muzny, Scherer, Kaul et al.: "The DNA sequence, annotation and analysis of human chromosome 3." in: Nature, Vol. 440, Issue 7088, pp. 1194-8, 2006 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN405856
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top