Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN405869

UDP-N-Acetyl-alpha-D-Galactosamine:polypeptide N-Acetylgalactosaminyltransferase 5 (GalNAc-T5) (GALNT5) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 4832424J23, GALNAC-T5, GALNACT5
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN405869
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-GALNT5 antibody: synthetic peptide directed towards the middle region of human GALNT5
Sequence ELSFKVWMCGGEIEIIPCSRVGHIFRNDNPYSFPKDRMKT VERNLVRVAE
Predicted Reactivity Bovine : 100%, Chicken : 100%, Dog : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Rabbit : 100%
Characteristics This is a rabbit polyclonal antibody against GALNT5. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name GALNT5
Background GALNT5 can catalyze the initial reaction in O-linked oligosaccharide biosynthesis,the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor. GALNT5 has activity toward EA2 peptide substrate, but it has a weak activity toward Muc2 or Muc1b substrates.
Molecular Weight 106kDa
Gene ID 11227
NCBI Accession NP_055383, NM_014568
UniProt Q7Z7M9
Research Area Organelles, Extracellular Matrix
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-GALNT5 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Simmons, Musy, Lopes et al.: "A direct interaction between EXT proteins and glycosyltransferases is defective in hereditary multiple exostoses." in: Human molecular genetics, Vol. 8, Issue 12, pp. 2155-64, 1999 (PubMed).

Alternatives for antigen "UDP-N-Acetyl-alpha-D-Galactosamine:polypeptide N-Acetylgalactosaminyltransferase 5 (GalNAc-T5) (GALNT5)", type "Antibodies"
Hosts (8)
Reactivities (6), (5), (1), (1), (1), (1), (1), (1)
Applications (7), (4), (3), (2), (1), (1)
Epitopes (4), (2), (2), (1), (1)
Beacon