Did you know that you can buy products from over 140 different suppliers from us?

UDP-N-Acetyl-alpha-D-Galactosamine:polypeptide N-Acetylgalactosaminyltransferase 5 (GalNAc-T5) (GALNT5) (Middle Region) antibody

Details for Product No. ABIN405869
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 4832424J23, GALNAC-T5, GALNACT5
Epitope
Middle Region
(9), (8), (2), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Human, Chicken
(12), (3)
Host
Rabbit
(14)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(13), (10), (8), (6), (2), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN405869
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human GALNT5
Sequence ELSFKVWMCGGEIEIIPCSRVGHIFRNDNPYSFPKDRMKT VERNLVRVAE
Predicted Reactivity Bovine : 100 %, Chicken : 100 %, Dog : 100 %, Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Rabbit : 100 %
Characteristics This is a rabbit polyclonal antibody against GALNT5. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name GALNT5
Background GALNT5 can catalyze the initial reaction in O-linked oligosaccharide biosynthesis,the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor. GALNT5 has activity toward EA2 peptide substrate, but it has a weak activity toward Muc2 or Muc1b substrates.
Molecular Weight 106 kDa
Gene ID 11227
NCBI Accession NM_014568, NP_055383
UniProt Q7Z7M9
Research Area Organelles, Extracellular Matrix
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 940 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-UDP-N-Acetyl-alpha-D-Galactosamine:polypeptide N-Acetylgalactosaminyltransferase 5 (GalNAc-T5) (GALNT5) (Middle Region) antibody WB Suggested Anti-GALNT5 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Hela cell lysate
Background publications Simmons, Musy, Lopes et al.: "A direct interaction between EXT proteins and glycosyltransferases is defective in hereditary multiple exostoses." in: Human molecular genetics, Vol. 8, Issue 12, pp. 2155-64, 1999 (PubMed).

Hosts (14)
Reactivities (12), (3)
Applications (13), (10), (8), (6), (2), (1)
Conjugates (1), (1), (1), (1), (1), (1)
Epitopes (9), (8), (2), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN405869
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top