Did you know that you can buy products from over 140 different suppliers from us?

Chromosome 2 Open Reading Frame 18 (C2orf18) (Middle Region) antibody

Details for Product No. ABIN405897
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ANT2BP, C2orf18, TANGO9, C3H2orf18, C13H2orf18
Epitope
Middle Region
(8), (7), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Zebrafish (Danio rerio), Human, Chicken
(10)
Host
Rabbit
(10), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(11), (8), (7), (6), (2), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN405897
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human C2orf18
Sequence GLFGFVILSLLLVPMYYIPAGSFSGNPRGTLEDALDAFCQ VGQQPLIAVA
Predicted Reactivity Human : 100 %
Characteristics This is a rabbit polyclonal antibody against C2orf18. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name C2orf18
Background The exact function of C2orf18 remains unknown.
Molecular Weight 40 kDa
Gene ID 54978
NCBI Accession NM_017877, NP_060347
UniProt Q8N357
Research Area Cancer
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 371 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Stelzl, Worm, Lalowski et al.: "A human protein-protein interaction network: a resource for annotating the proteome...." in: Cell, Vol. 122, Issue 6, pp. 957-68, 2005 (PubMed).

Hosts (10), (1)
Reactivities (10)
Applications (11), (8), (7), (6), (2), (1)
Conjugates (1), (1), (1), (1), (1), (1)
Epitopes (8), (7), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN405897
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top