Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN405897

Chromosome 2 Open Reading Frame 18 (C2orf18) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ANT2BP, C2orf18, TANGO9, C3H2orf18, C13H2orf18
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Zebrafish (Danio rerio), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN405897
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-C2orf18 antibody: synthetic peptide directed towards the middle region of human C2orf18
Sequence GLFGFVILSLLLVPMYYIPAGSFSGNPRGTLEDALDAFCQ VGQQPLIAVA
Predicted Reactivity Human : 100%
Characteristics This is a rabbit polyclonal antibody against C2orf18. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name C2orf18
Background The exact function of C2orf18 remains unknown.
Molecular Weight 40kDa
Gene ID 54978
NCBI Accession NP_060347, NM_017877
UniProt Q8N357
Research Area Cancer
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-C2orf18 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Stelzl, Worm, Lalowski et al.: "A human protein-protein interaction network: a resource for annotating the proteome." in: Cell, Vol. 122, Issue 6, pp. 957-68, 2005 (PubMed).

Alternatives for antigen "Chromosome 2 Open Reading Frame 18 (C2orf18)", type "Antibodies"
Hosts (4)
Reactivities (3)
Applications (4), (2), (2), (2), (1)
Epitopes (2), (2), (1)
Beacon