Did you know that you can buy products from over 140 different suppliers from us?

Keratin 23 (KRT23) (Middle Region) antibody

Details for Product No. ABIN405920
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CK23, Haik1, K23, Krt1-23, HAIK1
Epitope
Middle Region
(7), (3), (3), (2), (2), (1), (1), (1)
Reactivity
Dog (Canine), Human
(28), (1), (1)
Host
Rabbit
(18), (11)
Clonality
Polyclonal
Conjugate
Un-conjugated
(3), (1), (1), (1), (1), (1)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(27), (21), (8), (5), (5), (3), (3)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN405920
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human KRT23
Sequence IKTHLEKEITTYRRLLEGESEGTREESKSSMKVSATPKIK AITQETINGR
Predicted Reactivity Human : 100 %, Dog : 90 %, Horse : 80 %
Characteristics This is a rabbit polyclonal antibody against KRT23. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name KRT23
Background KRT23 is a member of the keratin family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. The type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains.The protein encoded by this gene is a member of the keratin family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. The type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains. The type I cytokeratin genes are clustered in a region of chromosome 17q12-q21.
Molecular Weight 48 kDa
Gene ID 25984
NCBI Accession NM_015515, NP_056330
UniProt Q9C075
Research Area Signaling, Cytoskeleton, Cytokeratins
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 422 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Keratin 23 (KRT23) (Middle Region) antibody WB Suggested Anti-KRT23 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: 721_B cell lysate
anti-Keratin 23 (KRT23) (Middle Region) antibody (2) Immunohistochemistry with Placenta tissue at an antibody concentration of 5µg/ml using anti-KRT23 antibody (ARP47466_P050)
Background publications Schweizer, Bowden, Coulombe et al.: "New consensus nomenclature for mammalian keratins." in: The Journal of cell biology, Vol. 174, Issue 2, pp. 169-74, 2006 (PubMed).

Validation Images
back to top