Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN405920

Keratin 23 (KRT23) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CK23, HAIK1, K23, Haik1, Krt1-23
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN405920
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-KRT23 antibody: synthetic peptide directed towards the middle region of human KRT23
Sequence IKTHLEKEITTYRRLLEGESEGTREESKSSMKVSATPKIK AITQETINGR
Predicted Reactivity Human : 100%, Dog : 92%, Horse : 85%
Characteristics This is a rabbit polyclonal antibody against KRT23. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name KRT23
Background KRT23 is a member of the keratin family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. The type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains.The protein encoded by this gene is a member of the keratin family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. The type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains. The type I cytokeratin genes are clustered in a region of chromosome 17q12-q21.
Molecular Weight 48kDa
Gene ID 25984
NCBI Accession NP_056330, NM_015515
UniProt Q9C075
Research Area Signaling, Cytoskeleton, Cytokeratins
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-KRT23 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Schweizer, Bowden, Coulombe et al.: "New consensus nomenclature for mammalian keratins." in: The Journal of cell biology, Vol. 174, Issue 2, pp. 169-74, 2006 (PubMed).

Alternatives for antigen "Keratin 23 (KRT23)", type "Antibodies"
Hosts (13), (11)
Reactivities (23)
Applications (22), (17), (10), (6), (4), (3), (2), (1)
Conjugates (2)
Epitopes (3), (3), (2), (2), (2), (1), (1), (1), (1), (1)
Beacon