Did you know that you can buy products from over 140 different suppliers from us?

PHD Finger Protein 12 (PHF12) (C-Term) antibody

Details for Product No. ABIN406118
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms PF1, 2410142K10Rik, F630045O13, mKIAA1523
Epitope
C-Term
(8), (8), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Xenopus laevis, Human
(7), (6)
Host
Rabbit
(12)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(11), (7), (6), (2), (2)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN406118
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human PHF12
Sequence NVLYSCDFSEKTPPTPPSSIVAKVQSVIRRRRHQKQDEEP SEEAAMMSSQ
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rabbit : 100 %, African clawed frog : 80 %, Chicken : 80 %
Characteristics This is a rabbit polyclonal antibody against PHF12. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name PHF12
Background PHF12 acts as a transcriptional repressor. It is involved in recruitment of functional SIN3A complexes to DNA. PHF12 represses transcription at least in part through the activity of an associated histone deacetylase (HDAC). IT may also repress transcription in a SIN3A-independent manner through recruitment of functional AES complexes to DNA.
Molecular Weight 110 kDa
Gene ID 57649
NCBI Accession NM_001033561, NP_001028733
UniProt Q96QT6
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 1004 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-PHD Finger Protein 12 (PHF12) (C-Term) antibody WB Suggested Anti-PHF12 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human brain
Background publications Nousiainen, Silljé, Sauer et al.: "Phosphoproteome analysis of the human mitotic spindle." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 103, Issue 14, pp. 5391-6, 2006 (PubMed).

Validation Images
back to top