Did you know that you can buy products from over 140 different suppliers from us?

SET and MYND Domain Containing 3 (SMYD3) (N-Term) antibody

Details for Product No. ABIN406136
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms KMT3E, ZMYND1, ZNFN3A1, bA74P14.1, Zmynd1, 2410008A19Rik
Epitope
N-Term
(4), (2), (2), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Pig (Porcine), Cow (Bovine), Human
(30), (16), (16), (13), (1), (1)
Host
Rabbit
(29), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB), Chromatin Immunoprecipitation (ChIP)
(21), (10), (7), (6), (5), (3), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN406136
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human SMYD3
Sequence PRYPPDSVRLLGRVVFKLMDGAPSESEKLYSFYDLESNIN KLTEDKKEGL
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Guinea pig : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rat : 100 %
Characteristics This is a rabbit polyclonal antibody against SMYD3. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name SMYD3
Background SMYD3 is a member of an RNA polymerase complex. Within the RNA polymerase complex, it acts as a histone methyltransferase that plays a role in transcriptional regulation.SMYD3 is a histone methyltransferase that plays a role in transcriptional regulation as a member of an RNA polymerase complex.
Molecular Weight 42 kDa
Gene ID 64754
NCBI Accession NM_022743, NP_073580
UniProt Q9H7B4-3
Research Area Cancer, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 369 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-SET and MYND Domain Containing 3 (SMYD3) (N-Term) antibody WB Suggested Anti-SMYD3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Stomach
Background publications Silva, Hamamoto, Kunizaki et al.: "Enhanced methyltransferase activity of SMYD3 by the cleavage of its N-terminal region in human cancer cells." in: Oncogene, Vol. 27, Issue 19, pp. 2686-92, 2008 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN406136
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top