Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN406155

Glucose Dehydrogenase (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CORTRD1, G6PDH, GDH, Gpd1, G6pd1, Gpd-1, AI785303, H6pdh, CG1152, Dmel\\CG1152, GLD, Go, gld, glucose dehydrogenase, l(3)84Cg
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Rabbit, Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN406155
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-H6PD antibody: synthetic peptide directed towards the N terminal of human H6PD
Sequence HFSAQQLATELGTFFQEEEMYRVDHYLGKQAVAQILPFRD QNRKALDGLW
Predicted Reactivity Dog : 100%, Guinea pig : 100%, Mouse : 100%, Rat : 100%, Bovine : 92%, Horse : 92%
Characteristics This is a rabbit polyclonal antibody against H6PD. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name H6PD
Background There are 2 forms of glucose-6-phosphate dehydrogenase. G form is X-linked and H form is autosomally linked. This H form shows activity with other hexose-6-phosphates, especially galactose-6-phosphate, whereas the G form is specific for glucose-6-phosphate. Both forms are present in most tissues, but H form is not found in red cells.There are 2 forms of glucose-6-phosphate dehydrogenase. G form is X-linked and H form, encoded by this gene, is autosomally linked. This H form shows activity with other hexose-6-phosphates, especially galactose-6-phosphate, whereas the G form is specific for glucose-6-phosphate. Both forms are present in most tissues, but H form is not found in red cells.
Molecular Weight 89kDa
Gene ID 9563
NCBI Accession NP_004276, NM_004285
UniProt O95479
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-H6PD antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Smit, Dekker, de Jong et al.: "Lack of Association of the 11beta-hydroxysteroid dehydrogenase type 1 gene 83,557insA and hexose-6-phosphate dehydrogenase gene R453Q polymorphisms with body composition, adrenal androgen production, blood pressure, glucose metabolism, and dementia." in: The Journal of clinical endocrinology and metabolism, Vol. 92, Issue 1, pp. 359-62, 2007 (PubMed).

Alternatives for antigen "Glucose Dehydrogenase", type "Antibodies"
Hosts (18), (10), (6)
Reactivities (17), (15), (4), (2), (1)
Applications (28), (22), (10), (6), (5), (5), (2), (1)
Conjugates (4), (3), (3)
Epitopes (2), (2), (2), (1), (1)
Beacon