Glucose Dehydrogenase (N-Term) antibody

Details for Product No. ABIN406155
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CORTRD1, G6PDH, GDH, Gpd1, G6pd1, Gpd-1, AI785303, H6pdh, CG1152, Dmel\\CG1152, GLD, Go, gld, glucose dehydrogenase, l(3)84Cg
Epitope
N-Term
(4), (1)
Reactivity
Rabbit, Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
(14), (12), (2), (2), (1)
Host
Rabbit
(13), (8), (7)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2)
Application
Western Blotting (WB)
(22), (16), (8), (6), (6), (5), (4), (1)
Pubmed 1 reference available
Catalog no. ABIN406155
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human H6PD
Sequence HFSAQQLATELGTFFQEEEMYRVDHYLGKQAVAQILPFRD QNRKALDGLW
Predicted Reactivity Dog : 100 %, Guinea pig : 100 %, Mouse : 100 %, Rat : 100 %, Bovine : 90 %, Horse : 90 %
Characteristics This is a rabbit polyclonal antibody against H6PD. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name H6PD
Background There are 2 forms of glucose-6-phosphate dehydrogenase. G form is X-linked and H form is autosomally linked. This H form shows activity with other hexose-6-phosphates, especially galactose-6-phosphate, whereas the G form is specific for glucose-6-phosphate. Both forms are present in most tissues, but H form is not found in red cells.There are 2 forms of glucose-6-phosphate dehydrogenase. G form is X-linked and H form, encoded by this gene, is autosomally linked. This H form shows activity with other hexose-6-phosphates, especially galactose-6-phosphate, whereas the G form is specific for glucose-6-phosphate. Both forms are present in most tissues, but H form is not found in red cells.
Molecular Weight 89 kDa
Gene ID 9563
NCBI Accession NM_004285, NP_004276
UniProt O95479
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 791 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Glucose Dehydrogenase (N-Term) antibody WB Suggested Anti-H6PD Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 721_B cell lysate
Background publications Smit, Dekker, de Jong et al.: "Lack of Association of the 11beta-hydroxysteroid dehydrogenase type 1 gene 83,557insA and hexose-6-phosphate dehydrogenase gene R453Q polymorphisms with body composition, adrenal androgen production, blood pressure, glucose metabolism, and dementia." in: The Journal of clinical endocrinology and metabolism, Vol. 92, Issue 1, pp. 359-62, 2007 (PubMed).

Hosts (13), (8), (7)
Reactivities (14), (12), (2), (2), (1)
Applications (22), (16), (8), (6), (6), (5), (4), (1)
Conjugates (2), (2), (2)
Epitopes (4), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top