Chromosome 2 Open Reading Frame 60 (C2orf60) (Middle Region) antibody

Details for Product No. ABIN406156
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms C2orf60, hTYW5, RGD1311269, C7H2orf60, 1110034B05Rik, JMJD5
Epitope
Middle Region
(2), (1)
Reactivity
Rat (Rattus), Mouse (Murine), Dog (Canine), Human
(17), (13), (13), (13), (12), (12), (1), (1)
Host
Rabbit
(17)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(10), (8), (3), (3)
Pubmed 1 reference available
Catalog no. ABIN406156
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human C2orf60
Sequence NKDPTAASRAAQILDRALKTLAELPEEYRDFYARRMVLHI QDKAYSKNSE
Predicted Reactivity Dog :100 %,   Human :100 %,   Rat :90 %,   Mouse :80 %,  
Characteristics This is a rabbit polyclonal antibody against C2orf60. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name C2orf60
Background The function of the C2orf60 protein remains unknown.
Molecular Weight 36 kDa
Gene ID 129450
NCBI Accession NM_001039693, NP_001034782
UniProt A2RUC4
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 315 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Chromosome 2 Open Reading Frame 60 (C2orf60) (Middle Region) antibody WB Suggested Anti-C2orf60 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Muscle
Background publications Brandenberger, Wei, Zhang et al.: "Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation." in: Nature biotechnology, Vol. 22, Issue 6, pp. 707-16, 2004 (PubMed).

Hosts (17)
Reactivities (17), (13), (13), (13), (12), (12), (1), (1)
Applications (10), (8), (3), (3)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (2), (1)
back to top