Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN406156

Chromosome 2 Open Reading Frame 60 (C2orf60) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms C2orf60, hTYW5, RGD1311269, C7H2orf60, 1110034B05Rik, JMJD5
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Rat (Rattus), Mouse (Murine), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN406156
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-C2orf60 antibody: synthetic peptide directed towards the middle region of human C2orf60
Sequence NKDPTAASRAAQILDRALKTLAELPEEYRDFYARRMVLHI QDKAYSKNSE
Predicted Reactivity Dog :100%,   Human :100%,   Rat :92%,   Mouse :85%,  
Characteristics This is a rabbit polyclonal antibody against C2orf60. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name C2orf60
Background The function of the C2orf60 protein remains unknown.
Molecular Weight 36kDa
Gene ID 129450
NCBI Accession NP_001034782, NM_001039693
UniProt A2RUC4
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-C2orf60 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Brandenberger, Wei, Zhang et al.: "Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation." in: Nature biotechnology, Vol. 22, Issue 6, pp. 707-16, 2004 (PubMed).

Alternatives for antigen "Chromosome 2 Open Reading Frame 60 (C2orf60)", type "Antibodies"
Hosts (18)
Reactivities (18), (13), (13), (13), (12), (12), (1), (1)
Applications (10), (9), (5), (3), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (2), (2)
Beacon