Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN406158

PHD Finger Protein 23 (PHF23) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 2410141M05Rik, JUNE-1, RP23-172M21.13, hJUNE-1b
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 2 references available
Catalog no. ABIN406158
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-PHF23 antibody: synthetic peptide directed towards the N terminal of human PHF23
Sequence LEAMAEPSPEDPPPTLKPETQPPEKRRRTIEDFNKFCSFV LAYAGYIPPS
Predicted Reactivity Bovine : 100%, Dog : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rabbit : 100%, Rat : 100%
Characteristics This is a rabbit polyclonal antibody against PHF23. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name PHF23
Background PHF23 contains 1 PHD-type zinc finger. It belongs to the PHF23 family. A chromosomal aberration involving PHF23, translocation t (11,17)(p15,p13) with NUP98, is found in a patient with acute myeloid leukemia (AML).
Molecular Weight 44kDa
Gene ID 79142
NCBI Accession NP_077273, NM_024297
UniProt Q9BUL5
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-PHF23 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Lazrek, Goffard, Schanen et al.: "Detection of hepatitis C virus antibodies and RNA among medicolegal autopsy cases in Northern France." in: Diagnostic microbiology and infectious disease, Vol. 55, Issue 1, pp. 55-8, 2006 (PubMed).

Background publications Kimura, Wakamatsu, Suzuki et al.: "Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes." in: Genome research, Vol. 16, Issue 1, pp. 55-65, 2006 (PubMed).

Alternatives for antigen "PHD Finger Protein 23 (PHF23)", type "Antibodies"
Hosts (6), (2)
Reactivities (7), (2)
Applications (8), (2), (2), (1)
Epitopes (3), (2)
Beacon