Integrator Complex Subunit 4 (INTS4) (Middle Region) antibody

Details for Product No. ABIN406176
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms INT4, MST093, AA692684, AW493223, 2610034N24Rik, RGD1305036, DDBDRAFT_0187061, DDBDRAFT_0234080, DDB_0187061, DDB_0234080
Epitope
Middle Region
(2), (1), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Xenopus laevis, Human, Chicken
(9), (2), (2)
Host
Rabbit
(8), (1)
Clonality
Polyclonal
Application
Western Blotting (WB)
(8), (5), (1), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN406176
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human INTS4
Sequence PAEVVKILQTMLRQSAFLHLPLPEQIHKASATIIEPAGES DNPLRFTSGL
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Horse : 100 %, Pig : 100 %, Rat : 100 %, Chicken : 90 %
Characteristics This is a rabbit polyclonal antibody against INTS4. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name INTS4
Background INTS4 is a subunit of the Integrator complex, which associates with the C-terminal domain of RNA polymerase II large subunit (POLR2A) and mediates 3-prime end processing of small nuclear RNAs U1 (RNU1) and U2 (RNU2).INTS4 is a subunit of the Integrator complex, which associates with the C-terminal domain of RNA polymerase II large subunit (POLR2A, MIM 180660) and mediates 3-prime end processing of small nuclear RNAs U1 (RNU1, MIM 180680) and U2 (RNU2, MIM 180690) (Baillat et al., 2005 [PubMed 16239144]).
Molecular Weight 108 kDa
Gene ID 92105
NCBI Accession NM_033547, NP_291025
UniProt Q96HW7
Research Area Chromatin and Nuclear Signaling, Transcription Factors, DNA/RNA
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 963 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Integrator Complex Subunit 4 (INTS4) (Middle Region) antibody WB Suggested Anti-INTS4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: Hela cell lysate
Background publications Baillat, Hakimi, Näär et al.: "Integrator, a multiprotein mediator of small nuclear RNA processing, associates with the C-terminal repeat of RNA polymerase II." in: Cell, Vol. 123, Issue 2, pp. 265-76, 2005 (PubMed).

Hosts (8), (1)
Reactivities (9), (2), (2)
Applications (8), (5), (1), (1), (1)
Epitopes (2), (1), (1), (1), (1), (1)
back to top