Did you know that you can buy products from over 140 different suppliers from us?

Metaxin 2 (MTX2) (N-Term) antibody

Details for Product No. ABIN406184
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 1500012G02Rik, wu:fc02d09, xmtx2
Epitope
N-Term
(8), (7), (2), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Pig (Porcine), Dog (Canine), Human, Chicken
(15), (3), (3)
Host
Rabbit
(14), (2)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(16), (10), (9), (8), (2), (2)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN406184
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human MTX2
Sequence YIAAEPWPENATLYQQLKGEQILLSDNAASLAVQAFLQMC NLPIKVVCRA
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Pig : 100 %, Rabbit : 100 %, Mouse : 90 %, Rat : 90 %, Chicken : 70 %
Characteristics This is a rabbit polyclonal antibody against MTX2. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name MTX2
Background MTX2 is highly similar to the metaxin 2 protein from mouse, which has been shown to interact with the mitochondrial membrane protein metaxin 1. Because of this similarity, it is thought that the encoded protein is peripherally associated with the cytosolic face of the outer mitochondrial membrane and be involved in the import of proteins into the mitochondrion.The protein encoded by this gene is highly similar to the metaxin 2 protein from mouse, which has been shown to interact with the mitochondrial membrane protein metaxin 1. Because of this similarity, it is thought that the encoded protein is peripherally associated with the cytosolic face of the outer mitochondrial membrane and be involved in the import of proteins into the mitochondrion. Two transcript variants encoding different isoforms have been found for this gene.
Molecular Weight 29 kDa
Gene ID 10651
NCBI Accession NM_001006635, NP_001006636
UniProt Q8IZ68
Research Area Signaling, Organelles
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 253 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Metaxin 2 (MTX2) (N-Term) antibody WB Suggested Anti-MTX2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: Jurkat cell lysate
Background publications Xie, Marusich, Souda et al.: "The mitochondrial inner membrane protein mitofilin exists as a complex with SAM50, metaxins 1 and 2, coiled-coil-helix coiled-coil-helix domain-containing protein 3 and 6 and DnaJC11." in: FEBS letters, Vol. 581, Issue 18, pp. 3545-9, 2007 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN406184
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top