Dynein, Cytoplasmic 1, Intermediate Chain 1 (DYNC1I1) (N-Term) antibody

Details for Product No. ABIN406196
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms DH IC-1, DNCI1, DNCIC1, DHIC-1, DIC, Dncic1, IC74, Dnci1
Epitope
N-Term
(4), (2)
Reactivity
Mouse (Murine), Rat (Rattus), Human, Chicken
(19), (16), (16), (2), (1)
Host
Rabbit
(21), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(13), (10), (5), (4), (3), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN406196
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human DYNC1I1
Sequence GSQDSGDLGPLTRTLQWDTDPSVLQLQSDSELGRRLHKLG VSKVTQVDFL
Predicted Reactivity Chicken : 100 %, Dog : 100 %, Guinea pig : 100 %, Human : 100 %, Mouse : 100 %, Rat : 90 %
Characteristics This is a rabbit polyclonal antibody against DYNC1I1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name DYNC1I1
Background The aldehyde dehydrogenases are a family of isozymes that may play a major role in the detoxification of aldehydes generated by alcohol metabolism and lipid peroxidation. ALDH3B1 is highly expressed in kidney and lung.
Molecular Weight 73 kDa
Gene ID 1780
NCBI Accession NM_004411, NP_004402
UniProt O14576
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 645 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Dynein, Cytoplasmic 1, Intermediate Chain 1 (DYNC1I1) (N-Term) antibody WB Suggested Anti-DYNC1I1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human brain
Background publications Pfister, Fisher, Gibbons et al.: "Cytoplasmic dynein nomenclature." in: The Journal of cell biology, Vol. 171, Issue 3, pp. 411-3, 2005 (PubMed).

Hosts (21), (1)
Reactivities (19), (16), (16), (2), (1)
Applications (13), (10), (5), (4), (3), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (4), (2)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top