Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN406196

Dynein, Cytoplasmic 1, Intermediate Chain 1 (DYNC1I1) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms DH IC-1, DNCI1, DNCIC1, DHIC-1, DIC, Dncic1, IC74, Dnci1
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN406196
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-DYNC1I1 antibody: synthetic peptide directed towards the N terminal of human DYNC1I1
Sequence GSQDSGDLGPLTRTLQWDTDPSVLQLQSDSELGRRLHKLG VSKVTQVDFL
Predicted Reactivity Chicken : 100%, Dog : 100%, Guinea pig : 100%, Human : 100%, Mouse : 100%, Rat : 92%
Characteristics This is a rabbit polyclonal antibody against DYNC1I1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name DYNC1I1
Background The aldehyde dehydrogenases are a family of isozymes that may play a major role in the detoxification of aldehydes generated by alcohol metabolism and lipid peroxidation. ALDH3B1 is highly expressed in kidney and lung.
Molecular Weight 73kDa
Gene ID 1780
NCBI Accession NP_004402, NM_004411
UniProt O14576
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-DYNC1I1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Pfister, Fisher, Gibbons et al.: "Cytoplasmic dynein nomenclature." in: The Journal of cell biology, Vol. 171, Issue 3, pp. 411-3, 2005 (PubMed).

Alternatives for antigen "Dynein, Cytoplasmic 1, Intermediate Chain 1 (DYNC1I1)", type "Antibodies"
Hosts (21), (3)
Reactivities (21), (17), (16), (2), (2), (2), (1), (1), (1), (1)
Applications (15), (10), (8), (3), (3), (3), (2), (2), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (4), (2)
Beacon