Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN406202

5,10-Methenyltetrahydrofolate Synthetase (5-Formyltetrahydrofolate Cyclo-Ligase) (MTHFS) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms HsT19268, AI119695, 1110034I12Rik, 2310020H23Rik, MTHFS
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN406202
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-MTHFS antibody: synthetic peptide directed towards the middle region of human MTHFS
Sequence TSWNIPQPGEGDVREEALSTGGLDLIFMPGLGFDKHGNRL GRGKGYYDAY
Predicted Reactivity Human : 100%, Mouse : 100%, Rat : 100%, Bovine : 78%
Characteristics This is a rabbit polyclonal antibody against MTHFS. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name MTHFS
Background The exact function of MTHFS remains unknown.
Molecular Weight 23kDa
Gene ID 10588
NCBI Accession NP_006432, NM_006441
UniProt P49914
Research Area Signaling, Metabolism
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-MTHFS antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Lee, Lan, Kricker et al.: "One-carbon metabolism gene polymorphisms and risk of non-Hodgkin lymphoma in Australia." in: Human genetics, Vol. 122, Issue 5, pp. 525-33, 2007 (PubMed).

Alternatives for antigen "5,10-Methenyltetrahydrofolate Synthetase (5-Formyltetrahydrofolate Cyclo-Ligase) (MTHFS)", type "Antibodies"
Hosts (12), (6), (3)
Reactivities (17), (7), (3), (1)
Applications (20), (11), (3), (1)
Epitopes (5), (3), (2), (2), (1), (1)
Beacon