Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN406231

Chromosome 6 Open Reading Frame 150 (C6orf150) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms C6orf150, cGAS, h-cGAS
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN406231
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-C6orf150 antibody: synthetic peptide directed towards the middle region of human C6orf150
Sequence VPKHAKEGNGFQEETWRLSFSHIEKEILNNHGKSKTCCEN KEEKCCRKDC
Predicted Reactivity Human : 100%
Characteristics This is a rabbit polyclonal antibody against C6orf150. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name C6orf150
Background The exact function of C6orf150 remains unknown.
Molecular Weight 59kDa
Gene ID 115004
NCBI Accession NP_612450, NM_138441
UniProt Q8N884
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-C6orf150 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Rush, Moritz, Lee et al.: "Immunoaffinity profiling of tyrosine phosphorylation in cancer cells." in: Nature biotechnology, Vol. 23, Issue 1, pp. 94-101, 2005 (PubMed).

Alternatives for antigen "Chromosome 6 Open Reading Frame 150 (C6orf150)", type "Antibodies"
Hosts (16)
Reactivities (15), (12), (12), (12), (12)
Applications (10), (7), (5), (3), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (2), (2), (1)
Beacon