Did you know that you can buy products from over 140 different suppliers from us?

Chromosome 6 Open Reading Frame 150 (C6orf150) (Middle Region) antibody

Details for Product No. ABIN406231
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms C6orf150, cGAS, h-cGAS
Epitope
Middle Region
(8), (6), (2), (1), (1)
Reactivity
Cow (Bovine), Human
(23), (12), (12), (12), (12)
Host
Rabbit
(23), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(15), (12), (10), (7), (3), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN406231
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human C6orf150
Sequence VPKHAKEGNGFQEETWRLSFSHIEKEILNNHGKSKTCCEN KEEKCCRKDC
Predicted Reactivity Human : 100 %
Characteristics This is a rabbit polyclonal antibody against C6orf150. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name C6orf150
Background The exact function of C6orf150 remains unknown.
Molecular Weight 59 kDa
Gene ID 115004
NCBI Accession NM_138441, NP_612450
UniProt Q8N884
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 522 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Chromosome 6 Open Reading Frame 150 (C6orf150) (Middle Region) antibody WB Suggested Anti-C6orf150 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate
Background publications Rush, Moritz, Lee et al.: "Immunoaffinity profiling of tyrosine phosphorylation in cancer cells." in: Nature biotechnology, Vol. 23, Issue 1, pp. 94-101, 2005 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN406231
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top