DENN/MADD Domain Containing 1B (DENND1B) (Middle Region) antibody

Details for Product No. ABIN406260
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms C1ORF18, C1orf218, FAM31B, Fam31b, 4632404N19Rik, 4930467M19Rik, 6820401H01Rik, F730008N07Rik, si:ch211-195i21.1
Epitope
Middle Region
(3), (2), (2), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Zebrafish (Danio rerio), Dog (Canine), Xenopus laevis, Cow (Bovine), Human, Chicken
(22), (13), (13), (12), (12)
Host
Rabbit
(22), (2)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(15), (10), (7), (4), (2), (2), (2), (1)
Pubmed 1 reference available
Catalog no. ABIN406260
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human DENND1B
Sequence PVNLSVNQEIFIACEQVLKDQPALVPHSYFIAPDVTGLPT IPESRNLTEY
Predicted Reactivity Chicken : 100 %, Dog : 100 %, Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rabbit : 100 %, Bovine : 90 %
Characteristics This is a rabbit polyclonal antibody against DENND1B. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name DENND1B
Background DENND1B contains 1 dDENN domain, 1 DENN domain and 1 uDENN domain. The function of the DENND1B protein remains unknown.
Molecular Weight 45 kDa
Gene ID 163486
NCBI Accession NM_144977, NP_659414
UniProt Q6P3S1
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 396 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-DENN/MADD Domain Containing 1B (DENND1B) (Middle Region) antibody WB Suggested Anti-DENND1B Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: 293T cell lysate
Background publications Ota, Suzuki, Nishikawa et al.: "Complete sequencing and characterization of 21,243 full-length human cDNAs." in: Nature genetics, Vol. 36, Issue 1, pp. 40-5, 2003 (PubMed).

Hosts (22), (2)
Reactivities (22), (13), (13), (12), (12)
Applications (15), (10), (7), (4), (2), (2), (2), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (3), (2), (2), (1), (1), (1)
back to top