serine/threonine Kinase 32A (STK32A) (N-Term) antibody

Details for Product No. ABIN406264
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms YANK1, A930015B13Rik
Epitope
N-Term
(4), (4), (3), (2), (2), (2), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human
(20), (6), (2)
Host
Rabbit
(14), (7)
Clonality
Polyclonal
Application
Western Blotting (WB)
(15), (8), (3), (2), (2), (2), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN406264
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human STK32A
Sequence GANTSRKPPVFDENEDVNFDHFEILRAIGKGSFGKVCIVQ KNDTKKMYAM
Predicted Reactivity Human : 100 %, Bovine : 90 %, Dog : 90 %, Rabbit : 90 %, Guinea pig : 70 %, Horse : 70 %, Rat : 70 %
Characteristics This is a rabbit polyclonal antibody against STK32A. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name STK32A
Background STK32A belongs to the protein kinase superfamily, Ser/Thr protein kinase family. It contains 1 protein kinase domain. The function of the STK32A protein remains unknown.
Molecular Weight 20 kDa
Gene ID 202374
NCBI Accession NM_145001, NP_659438
UniProt Q8WU08-2
Research Area Signaling
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 166 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-serine/threonine Kinase 32A (STK32A) (N-Term) antibody WB Suggested Anti-STK32A Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 721_B cell lysate
Background publications Schmutz, Martin, Terry et al.: "The DNA sequence and comparative analysis of human chromosome 5." in: Nature, Vol. 431, Issue 7006, pp. 268-74, 2004 (PubMed).

Hosts (14), (7)
Reactivities (20), (6), (2)
Applications (15), (8), (3), (2), (2), (2), (1), (1)
Epitopes (4), (4), (3), (2), (2), (2), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top