Family With Sequence Similarity 119A (FAM119A) (N-Term) antibody

Details for Product No. ABIN406274
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms 2310038H17Rik, AI464204, Fam119a, RGD1311824, FAM119A, HCA557b
Epitope
N-Term
(1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human
(12), (3), (3), (1), (1)
Host
Rabbit
(7), (7)
Clonality
Polyclonal
Application
Western Blotting (WB)
(14), (3), (2), (2), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN406274
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human FAM119A
Sequence ALVPYEETTEFGLQKFHKPLATFSFANHTIQIRQDWRHLG VAAVVWDAAI
Predicted Reactivity Dog :100 %,   Mouse :100 %,   Human :100 %,   Bovine :90 %,   Rat :90 %,   Sumatran orangutan :90 %,  
Characteristics This is a rabbit polyclonal antibody against FAM119A. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name FAM119A
Background FAM119A is a multi-pass membrane protein. It belongs to the FAM119 family. The function of the FAM119A protein remains unknown.
Molecular Weight 24 kDa
Gene ID 151194
NCBI Accession NM_145280, NP_660323
UniProt Q8WXB1
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 218 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Family With Sequence Similarity 119A (FAM119A) (N-Term) antibody WB Suggested Anti-FAM119A Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human brain
Background publications Ota, Suzuki, Nishikawa et al.: "Complete sequencing and characterization of 21,243 full-length human cDNAs." in: Nature genetics, Vol. 36, Issue 1, pp. 40-5, 2003 (PubMed).

Hosts (7), (7)
Reactivities (12), (3), (3), (1), (1)
Applications (14), (3), (2), (2), (1), (1)
Epitopes (1), (1), (1)
back to top