Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN406274

Family With Sequence Similarity 119A (FAM119A) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 2310038H17Rik, AI464204, Fam119a, RGD1311824, FAM119A, HCA557b
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN406274
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-FAM119A antibody: synthetic peptide directed towards the N terminal of human FAM119A
Sequence ALVPYEETTEFGLQKFHKPLATFSFANHTIQIRQDWRHLG VAAVVWDAAI
Predicted Reactivity Dog :100%,   Mouse :100%,   Human :100%,   Bovine :92%,   Rat :92%,   Sumatran orangutan :92%,  
Characteristics This is a rabbit polyclonal antibody against FAM119A. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name FAM119A
Background FAM119A is a multi-pass membrane protein. It belongs to the FAM119 family. The function of the FAM119A protein remains unknown.
Molecular Weight 24kDa
Gene ID 151194
NCBI Accession NP_660323, NM_145280
UniProt Q8WXB1
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-FAM119A antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Ota, Suzuki, Nishikawa et al.: "Complete sequencing and characterization of 21,243 full-length human cDNAs." in: Nature genetics, Vol. 36, Issue 1, pp. 40-5, 2003 (PubMed).

Alternatives for antigen "Family With Sequence Similarity 119A (FAM119A)", type "Antibodies"
Hosts (8), (7)
Reactivities (13), (3), (3), (1), (1)
Applications (15), (5), (3), (2), (1), (1)
Epitopes (1), (1), (1), (1)
Beacon