Did you know that you can buy products from over 140 different suppliers from us?

Tandem C2 Domains, Nuclear (TC2N) (Middle Region) antibody

Details for Product No. ABIN406277
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 4933406D09Rik, Mtac2d1, Tac2-N, MTAC2D1, C14orf47, C2CD1
Epitope
Middle Region
(9), (8), (2), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Xenopus laevis, Human, Chicken
(13), (3)
Host
Rabbit
(14)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(14), (8), (7), (2)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN406277
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human TC2N
Sequence SWPSSYGDTPTVSIKGILTLPKPVHFKSSAKEGSNAIEFM ETFVFAIKLQ
Predicted Reactivity Dog : 100 %, Horse : 100 %, Mouse : 100 %, Bovine : 90 %, Chicken : 90 %, Pig : 90 %, Rat : 90 %, Rabbit : 80 %
Characteristics This is a rabbit polyclonal antibody against TC2N. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name TC2N
Background The specific function of TC2N is not yet known.
Molecular Weight 55 kDa
Gene ID 123036
NCBI Accession NM_152332, NP_689545
UniProt Q8N9U0
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 490 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Tandem C2 Domains, Nuclear (TC2N) (Middle Region) antibody WB Suggested Anti-TC2N Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: MCF7 cell lysate
Product cited in: Mehrle, Rosenfelder, Schupp et al.: "The LIFEdb database in 2006." in: Nucleic acids research, Vol. 34, Issue Database issue, pp. D415-8, 2005 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN406277
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top