Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN406277

Tandem C2 Domains, Nuclear (TC2N) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 4933406D09Rik, Mtac2d1, Tac2-N, MTAC2D1, C14orf47, C2CD1
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Xenopus laevis, Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN406277
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-TC2N antibody: synthetic peptide directed towards the middle region of human TC2N
Sequence SWPSSYGDTPTVSIKGILTLPKPVHFKSSAKEGSNAIEFM ETFVFAIKLQ
Predicted Reactivity Dog : 100%, Horse : 100%, Mouse : 100%, Bovine : 92%, Chicken : 92%, Pig : 92%, Rat : 92%, Rabbit : 84%
Characteristics This is a rabbit polyclonal antibody against TC2N. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name TC2N
Background The specific function of TC2N is not yet known.
Molecular Weight 55kDa
Gene ID 123036
NCBI Accession NP_689545, NM_152332
UniProt Q8N9U0
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-TC2N antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Mehrle, Rosenfelder, Schupp et al.: "The LIFEdb database in 2006." in: Nucleic acids research, Vol. 34, Issue Database issue, pp. D415-8, 2005 (PubMed).

Alternatives for antigen "Tandem C2 Domains, Nuclear (TC2N)", type "Antibodies"
Hosts (6)
Reactivities (5), (2)
Applications (6), (2), (2), (1)
Epitopes (2), (2), (1)
Beacon