Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN406278

Chromosome 15 Open Reading Frame 27 (C15orf27) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms C10H15orf27
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN406278
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-C15orf27 antibody: synthetic peptide directed towards the middle region of human C15orf27
Sequence PAGSAQTSPELEHRVSLFNQKNQEGFTVFQIRPVIHFQPT VPMLEDKFRS
Predicted Reactivity Rabbit : 85%, Dog : 78%
Characteristics This is a rabbit polyclonal antibody against C15orf27. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name C15orf27
Background The exact function of C15orf27 remains unknown.
Molecular Weight 58kDa
Gene ID 123591
NCBI Accession NP_689548, NM_152335
UniProt Q2M3C6
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-C15orf27 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Zody, Garber, Sharpe et al.: "Analysis of the DNA sequence and duplication history of human chromosome 15." in: Nature, Vol. 440, Issue 7084, pp. 671-5, 2006 (PubMed).

Alternatives for antigen "Chromosome 15 Open Reading Frame 27 (C15orf27)", type "Antibodies"
Hosts (7)
Reactivities (5), (3), (1), (1), (1), (1)
Applications (7), (3), (1), (1)
Epitopes (2), (2), (2), (1)
Beacon