Chromosome 15 Open Reading Frame 27 (C15orf27) (Middle Region) antibody

Details for Product No. ABIN406278
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms C10H15orf27
Epitope
Middle Region
(2), (2), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human
(5), (2), (1), (1), (1), (1)
Host
Rabbit
(7)
Clonality
Polyclonal
Application
Western Blotting (WB)
(7), (1), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN406278
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human C15orf27
Sequence PAGSAQTSPELEHRVSLFNQKNQEGFTVFQIRPVIHFQPT VPMLEDKFRS
Predicted Reactivity Rabbit : 85 %, Dog : 75 %
Characteristics This is a rabbit polyclonal antibody against C15orf27. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name C15orf27
Background The exact function of C15orf27 remains unknown.
Molecular Weight 58 kDa
Gene ID 123591
NCBI Accession NM_152335, NP_689548
UniProt Q2M3C6
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 531 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Chromosome 15 Open Reading Frame 27 (C15orf27) (Middle Region) antibody WB Suggested Anti-C15orf27 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 293T cell lysate
Background publications Zody, Garber, Sharpe et al.: "Analysis of the DNA sequence and duplication history of human chromosome 15...." in: Nature, Vol. 440, Issue 7084, pp. 671-5, 2006 (PubMed).

Hosts (7)
Reactivities (5), (2), (1), (1), (1), (1)
Applications (7), (1), (1), (1)
Epitopes (2), (2), (1), (1)
back to top