Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN406284

Keratin 222 (KRT222) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms KA21, KRT222P, 6330509G02Rik
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN406284
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-KRT222P antibody: synthetic peptide directed towards the N terminal of human KRT222P
Sequence ELSQLLNEIRANYEKILTRNQIETVLSTRIQLEEDISKKM DKDEEALKAA
Predicted Reactivity Rat :100%,   Dog :100%,   Bovine :100%,   Mouse :100%,   Human :100%,   Eubacterium siraeum DSM 15702 :90%,   Eubacterium siraeum 70/3 :90%,  
Characteristics This is a rabbit polyclonal antibody against KRT222P. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name KRT222P
Background KRT222P belongs to the intermediate filament family. The exact function of KRT222P is not known.
Molecular Weight 34kDa
Gene ID 125113
NCBI Accession NP_689562, NM_152349
UniProt Q8N1A0
Research Area Cytoskeleton
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-KRT222P antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Schweizer, Bowden, Coulombe et al.: "New consensus nomenclature for mammalian keratins." in: The Journal of cell biology, Vol. 174, Issue 2, pp. 169-74, 2006 (PubMed).

Alternatives for antigen "Keratin 222 (KRT222)", type "Antibodies"
Hosts (5)
Reactivities (4), (3)
Applications (5), (2)
Epitopes (4), (2), (2), (1)
Beacon