Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN406285

Tumor Necrosis Factor, alpha-Induced Protein 8-Like 1 (TNFAIP8L1) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 2600017J23Rik, TIPE1
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Cow (Bovine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN406285
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-TNFAIP8L1 antibody: synthetic peptide directed towards the middle region of human TNFAIP8L1
Sequence AKSHGRINHVFGHLADCDFLAALYGPAEPYRSHLRRICEG LGRMLDEGSL
Predicted Reactivity Dog : 100%, Chicken : 85%
Characteristics This is a rabbit polyclonal antibody against TNFAIP8L1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name TNFAIP8L1
Background TNFAIP8L1 belongs to the TNFAIP8 family. The exact function of TNFAIP8L is not known.
Molecular Weight 21kDa
Gene ID 126282
NCBI Accession NP_689575, NM_152362
UniProt Q8WVP5
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-TNFAIP8L1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Rual, Venkatesan, Hao et al.: "Towards a proteome-scale map of the human protein-protein interaction network." in: Nature, Vol. 437, Issue 7062, pp. 1173-8, 2005 (PubMed).

Alternatives for antigen "Tumor Necrosis Factor, alpha-Induced Protein 8-Like 1 (TNFAIP8L1)", type "Antibodies"
Hosts (3)
Reactivities (1)
Applications (2), (1)
Epitopes (1)
Beacon