Did you know that you can buy products from over 140 different suppliers from us?

Tumor Necrosis Factor, alpha-Induced Protein 8-Like 1 (TNFAIP8L1) (Middle Region) antibody

Details for Product No. ABIN406285
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 2600017J23Rik, TIPE1
Epitope
Middle Region
(1)
Reactivity
Mouse (Murine), Cow (Bovine), Human, Chicken
(2)
Host
Rabbit
(3), (1)
Clonality
Polyclonal
Application
Western Blotting (WB)
(3), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN406285
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human TNFAIP8L1
Sequence AKSHGRINHVFGHLADCDFLAALYGPAEPYRSHLRRICEG LGRMLDEGSL
Predicted Reactivity Dog : 100 %, Chicken : 80 %
Characteristics This is a rabbit polyclonal antibody against TNFAIP8L1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name TNFAIP8L1
Background TNFAIP8L1 belongs to the TNFAIP8 family. The exact function of TNFAIP8L is not known.
Molecular Weight 21 kDa
Gene ID 126282
NCBI Accession NM_152362, NP_689575
UniProt Q8WVP5
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 186 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Tumor Necrosis Factor, alpha-Induced Protein 8-Like 1 (TNFAIP8L1) (Middle Region) antibody WB Suggested Anti-TNFAIP8L1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2 cell lysate
Background publications Rual, Venkatesan, Hao et al.: "Towards a proteome-scale map of the human protein-protein interaction network." in: Nature, Vol. 437, Issue 7062, pp. 1173-8, 2005 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN406285
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top