Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN406300

Butyrophilin-Like 9 (BTNL9) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms BTN3, VDLS1900, B430208I01, Btn3, D330012D11Rik, Btnl9, MGC157148
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN406300
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-BTNL9 antibody: synthetic peptide directed towards the N terminal of human BTNL9
Sequence EIRWFRSQTFNVVHLYQEQQELPGRQMPAFRNRTKLVKDD IAYGSVVLQL
Predicted Reactivity Human : 100%, Horse : 78%
Characteristics This is a rabbit polyclonal antibody against BTNL9. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name BTNL9
Background The specific function of BTNL9 is not yet known.
Molecular Weight 60kDa
Gene ID 153579
NCBI Accession NP_689760, NM_152547
UniProt Q6UXG8
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-BTNL9 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Clark, Gurney, Abaya et al.: "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment." in: Genome research, Vol. 13, Issue 10, pp. 2265-70, 2003 (PubMed).

Alternatives for antigen "Butyrophilin-Like 9 (BTNL9)", type "Antibodies"
Hosts (3)
Reactivities (2), (1), (1), (1), (1)
Applications (3), (1)
Epitopes (1), (1), (1)
Beacon