Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN406317

Chromosome 22 Open Reading Frame 25 (C22orf25) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms C22orf25, c22orf25, TANGO2, C17H22orf25, MGC88919
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Zebrafish (Danio rerio), Xenopus laevis, Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN406317
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-C22orf25 antibody: synthetic peptide directed towards the N terminal of human C22orf25
Sequence MCIIFFKFDPRPVSKNAYRLILAANRDEFYSRPSKLADFW GNNNEILSGL
Predicted Reactivity Dog : 100%, Human : 100%, Pig : 100%, African clawed frog : 92%
Characteristics This is a rabbit polyclonal antibody against C22orf25. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name C22orf25
Background The exact functions of C22orf25 remain unknown.
Molecular Weight 31kDa
Gene ID 128989
NCBI Accession NP_690870, NM_152906
UniProt Q6ICL3
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-C22orf25 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Collins, Wright, Edwards et al.: "A genome annotation-driven approach to cloning the human ORFeome." in: Genome biology, Vol. 5, Issue 10, pp. R84, 2004 (PubMed).

Alternatives for antigen "Chromosome 22 Open Reading Frame 25 (C22orf25)", type "Antibodies"
Hosts (15)
Reactivities (14), (13), (13), (13), (13), (12), (12), (1), (1), (1)
Applications (10), (6), (3), (3)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (1), (1), (1)
Beacon