Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN406375

LOC81691 (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Epitope
Middle Region
Reactivity
Rat (Rattus), Mouse (Murine), Dog (Canine), Cow (Bovine), Human
Host
Rabbit
Clonality Polyclonal
Application
Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN406375
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-LOC81691 antibody: synthetic peptide directed towards the middle region of human LOC81691
Sequence AEGGCCVMDELVKPENKILDYLTSFSGITKKILNPVTTKL KDVQRQLKAL
Predicted Reactivity Crab-eating macaque :100%,   Human :100%,   Dog :92%,   Rat :85%,   Bovine :85%,   Mouse :84%,   Yellowfever mosquito :84%,   Green puffer :78%,  
Characteristics This is a rabbit polyclonal antibody against LOC81691. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Background The exact functions of LOC81691 remain unknown.
Molecular Weight 85kDa
Gene ID 81691
NCBI Accession NP_112203, NM_030941
UniProt Q96IC2
Research Area Chromatin and Nuclear Signaling, Chromatin Binding Proteins
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-LOC81691 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Mehrle, Rosenfelder, Schupp et al.: "The LIFEdb database in 2006." in: Nucleic acids research, Vol. 34, Issue Database issue, pp. D415-8, 2005 (PubMed).

Beacon