Did you know that you can buy products from over 140 different suppliers from us?

Integrin beta 3 Binding Protein (Beta3-Endonexin) (ITGB3BP) (N-Term) antibody

Details for Product No. ABIN406460
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CENP-R, CENPR, HSU37139, NRIF3, TAP20, 4930471O16Rik, AU022583
Epitope
N-Term
(8), (1), (1), (1)
Reactivity
Human
(17), (1), (1)
Host
Rabbit
(9), (9)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(18), (11), (6), (2), (2)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN406460
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human ITGB3BP
Sequence TGTCQMSLFASPTSSEEQKHRNGLSNEKRKKLNHPSLTES KESTTKDNDE
Predicted Reactivity Human : 100 %
Characteristics This is a rabbit polyclonal antibody against ITGB3BP. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ITGB3BP
Background ITGB3BP is a transcription coregulator that can have both coactivator and corepressor functions. Isoform 1, but not other isoforms, is involved in the coactivation of nuclear receptors for retinoid X (RXRs) and thyroid hormone (TRs) in a ligand-dependent fashion. ITGB3BP acts as a transcriptional corepressor via its interaction with the NFKB1 NF-kappa-B subunit, possibly by interfering with the transactivation domain of NFKB1. It induces apoptosis in breast cancer cells, but not in other cancer cells, via a caspase-2 mediated pathway that involves mitochondrial membrane permeabilization but does not require other caspases. ITGB3BP may also act as an inhibitor of cyclin A-associated kinase. ITGB3BP may be involved in incorporation of newly synthesized CENPA into centromeres via its interaction with the CENPA-NAC complex.
Molecular Weight 20 kDa
Gene ID 23421
NCBI Accession NM_014288, NP_055103
UniProt Q13352
Research Area Chromatin and Nuclear Signaling, Cell Cycle
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 177 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Integrin beta 3 Binding Protein (Beta3-Endonexin) (ITGB3BP) (N-Term) antibody WB Suggested Anti-ITGB3BP Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: MCF7 cell lysate
Background publications Gregory, Barlow, McLay et al.: "The DNA sequence and biological annotation of human chromosome 1." in: Nature, Vol. 441, Issue 7091, pp. 315-21, 2006 (PubMed).

Validation Images
back to top