Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN406460

Integrin beta 3 Binding Protein (Beta3-Endonexin) (ITGB3BP) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CENPR, NRIF3, TAP20, CENP-R, HSU37139, AU022583, 4930471O16Rik
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN406460
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ITGB3BP antibody: synthetic peptide directed towards the N terminal of human ITGB3BP
Sequence TGTCQMSLFASPTSSEEQKHRNGLSNEKRKKLNHPSLTES KESTTKDNDE
Predicted Reactivity Human : 100%
Characteristics This is a rabbit polyclonal antibody against ITGB3BP. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ITGB3BP
Background ITGB3BP is a transcription coregulator that can have both coactivator and corepressor functions. Isoform 1, but not other isoforms, is involved in the coactivation of nuclear receptors for retinoid X (RXRs) and thyroid hormone (TRs) in a ligand-dependent fashion. ITGB3BP acts as a transcriptional corepressor via its interaction with the NFKB1 NF-kappa-B subunit, possibly by interfering with the transactivation domain of NFKB1. It induces apoptosis in breast cancer cells, but not in other cancer cells, via a caspase-2 mediated pathway that involves mitochondrial membrane permeabilization but does not require other caspases. ITGB3BP may also act as an inhibitor of cyclin A-associated kinase. ITGB3BP may be involved in incorporation of newly synthesized CENPA into centromeres via its interaction with the CENPA-NAC complex.
Molecular Weight 20kDa
Gene ID 23421
NCBI Accession NP_055103, NM_014288
UniProt Q13352
Research Area Chromatin and Nuclear Signaling, Cell Cycle
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ITGB3BP antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Gregory, Barlow, McLay et al.: "The DNA sequence and biological annotation of human chromosome 1." in: Nature, Vol. 441, Issue 7091, pp. 315-21, 2006 (PubMed).

Alternatives for antigen "Integrin beta 3 Binding Protein (Beta3-Endonexin) (ITGB3BP)", type "Antibodies"
Hosts (7), (4)
Reactivities (10)
Applications (10), (7), (3), (2), (1)
Epitopes (1), (1), (1)
Beacon