Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Coiled-Coil Domain Containing 69 (CCDC69) antibody

Antigen

Coiled-Coil Domain Containing 69 (CCDC69)

Synonyms FLJ13705, DKFZp434C171, D11Ertd461e, 2210021E03Rik, ccdc69, MGC83627, RGD1562251, MGC147153
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Fruit Fly (Drosophila melanogaster)

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN406496
Quantity 50 µg
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name CCDC69
Gene ID CCDC69
UniProt A6NI79
Immunogen The immunogen for anti-CCDC69 antibody: synthetic peptide directed towards the middle region of human CCDC69
Sequence TREALEKEVQLRRQLQQEKEELLYRVLGANASPAFPLAPV TPTEVSFLAT
Cross-Reactivity Cow (Bovine), Fruit Fly (Drosophila melanogaster), Human
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-CCDC69 antibody concentration is 1 mg/ml.
Description The function of CCDC69 remains unknown.
Characteristics Antigen Size: 296 amino acids
Molecular Weight 35kDa

Application Details

Application Notes WB Suggested Anti-CCDC69 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: 293T cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Suzuki, Yoshitomo-Nakagawa, Maruyama et al.: "Construction and characterization of a full length-enriched and a 5'-end-enriched cDNA library." in: Gene, Vol. 200, Issue 1-2, pp. 149-56, 1997 (PubMed).

Alternatives

Alternatives for antigen "Coiled-Coil Domain Containing 69 (CCDC69)", type "Antibodies"
Hosts Rabbit (20), Chicken (3)
Reactivities Human (22), Mouse (Murine) (2), Rat (Rattus) (2)
Applications Immunofluorescence (IF) (14), Western Blotting (WB) (8), ELISA (7), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (2), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (2), Immunoelectron Microscopy (IEM) (1), Immunohistochemistry (IHC) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy5.5 (1), PE,Cy7 (1)
Epitopes N-Term (2), Center (1), Internal Region (1)