Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN406530

Adenylate Kinase Domain Containing 1 (ADK1) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms AKD1, AKD2, C6orf199, C6orf224, RP1-70A9.1, dJ70A9.1, Akd1, Akd2, Gm234, Gm7127, akd1, si:ch211-199m3.2, akd2
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN406530
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-C6orf199 antibody: synthetic peptide directed towards the middle region of human C6orf199
Sequence IINIKCPDYDLCQRISGQRQHNNTGYIYSRDQWDPEVIEN HRKKKKEAQK
Predicted Reactivity Crab-eating macaque :100%,   Human :100%,  
Characteristics This is a rabbit polyclonal antibody against C6orf199. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name C6orf199
Background The exact function of this protein remains unknown.
Molecular Weight 48kDa
Gene ID 221264
NCBI Accession NP_659462, NM_145025
UniProt Q5TCS8
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-C6orf199 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Ota, Suzuki, Nishikawa et al.: "Complete sequencing and characterization of 21,243 full-length human cDNAs." in: Nature genetics, Vol. 36, Issue 1, pp. 40-5, 2003 (PubMed).

Alternatives for antigen "Adenylate Kinase Domain Containing 1 (ADK1)", type "Antibodies"
Hosts (21), (2)
Reactivities (21), (13), (12), (12), (12), (1)
Applications (12), (10), (7), (5), (2), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (2), (2), (1)
Beacon