Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN406536

Non-SMC Condensin II Complex, Subunit H2 (NCAPH2) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CAPH2, MGC81656, si:dkey-202b22.2
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN406536
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-NCAPH2 antibody: synthetic peptide directed towards the N terminal of human NCAPH2
Sequence EYLYSLVYQALDFISGKRRAKQLSSVQEDRANGVASSGVP QEAENEFLSL
Predicted Reactivity Guinea pig : 100%, Human : 100%, Mouse : 100%, Rabbit : 100%, Rat : 100%, Dog : 92%, Horse : 92%, Pig : 91%
Characteristics This is a rabbit polyclonal antibody against NCAPH2. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name NCAPH2
Background Condensin complexes I and II play essential roles in mitotic chromosome assembly and segregation. Both condensins contain 2 invariant structural maintenance of chromosome (SMC) subunits, SMC2 and SMC4, but they contain different sets of non-SMC subunits. NCAPH2 is 1 of 3 non-SMC subunits that define condensin II.Condensin complexes I and II play essential roles in mitotic chromosome assembly and segregation. Both condensins contain 2 invariant structural maintenance of chromosome (SMC) subunits, SMC2 (MIM 605576) and SMC4 (MIM 605575), but they contain different sets of non-SMC subunits. NCAPH2 is 1 of 3 non-SMC subunits that define condensin II (Ono et al., 2003 [PubMed 14532007]).
Molecular Weight 68kDa
Gene ID 29781
NCBI Accession NP_689512, NM_152299
UniProt Q6IBW4
Research Area Chromatin and Nuclear Signaling, Cell Cycle
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-NCAPH2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Ono, Losada, Hirano et al.: "Differential contributions of condensin I and condensin II to mitotic chromosome architecture in vertebrate cells." in: Cell, Vol. 115, Issue 1, pp. 109-21, 2003 (PubMed).

Alternatives for antigen "Non-SMC Condensin II Complex, Subunit H2 (NCAPH2)", type "Antibodies"
Hosts (13)
Reactivities (11), (1), (1), (1)
Applications (12), (5), (2)
Epitopes (7), (2)
Beacon