Did you know that you can buy products from over 140 different suppliers from us?

Non-SMC Condensin II Complex, Subunit H2 (NCAPH2) (N-Term) antibody

Details for Product No. ABIN406537
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CAPH2, MGC81656, si:dkey-202b22.2
Epitope
N-Term
(11), (2), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Human
(16), (1), (1), (1), (1)
Host
Rabbit
(18)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(16), (9), (3), (3), (2)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN406537
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human NCAPH2
Sequence SGVPQEAENEFLSLDDFPDSRTNVDLKNDQTPSEVLIIPL LPMALVAPDE
Predicted Reactivity Human : 100 %, Mouse : 90 %, Rabbit : 90 %, Rat : 90 %, Horse : 80 %
Characteristics This is a rabbit polyclonal antibody against NCAPH2. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name NCAPH2
Background Condensin complexes I and II play essential roles in mitotic chromosome assembly and segregation. Both condensins contain 2 invariant structural maintenance of chromosome (SMC) subunits, SMC2 and SMC4, but they contain different sets of non-SMC subunits. NCAPH2 is 1 of 3 non-SMC subunits that define condensin II.Condensin complexes I and II play essential roles in mitotic chromosome assembly and segregation. Both condensins contain 2 invariant structural maintenance of chromosome (SMC) subunits, SMC2 (MIM 605576) and SMC4 (MIM 605575), but they contain different sets of non-SMC subunits. NCAPH2 is 1 of 3 non-SMC subunits that define condensin II (Ono et al., 2003 [PubMed 14532007]).
Molecular Weight 68 kDa
Gene ID 29781
NCBI Accession NM_152299, NP_689512
UniProt Q6IBW4
Research Area Chromatin and Nuclear Signaling, Cell Cycle
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 605 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Non-SMC Condensin II Complex, Subunit H2 (NCAPH2) (N-Term) antibody WB Suggested Anti-NCAPH2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: 721_B cell lysate
Background publications Ono, Losada, Hirano et al.: "Differential contributions of condensin I and condensin II to mitotic chromosome architecture in vertebrate cells." in: Cell, Vol. 115, Issue 1, pp. 109-21, 2003 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN406537
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top