Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN406540

MGC26647 (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Epitope
N-Term
Reactivity
Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN406540
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-MGC26647 antibody: synthetic peptide directed towards the N terminal of human MGC26647
Sequence EEKQRLHLKKFLLDRMFLVAKIQANVERKDVADYYEQMFQ SVLKHHLGEA
Predicted Reactivity African malaria mosquito :100%,   Human :100%,   Bovine :76%,  
Characteristics This is a rabbit polyclonal antibody against MGC26647. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Background The exact function of MGC26647 remains unknown.
Molecular Weight 29kDa
Gene ID 219557
NCBI Accession NP_689919, NM_152706
UniProt Q8TBZ9
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-MGC26647 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Scherer, Cheung, MacDonald et al.: "Human chromosome 7: DNA sequence and biology." in: Science (New York, N.Y.), Vol. 300, Issue 5620, pp. 767-72, 2003 (PubMed).

Alternatives for antigen "MGC26647", type "Antibodies"
Hosts (1)
Applications (1)
Beacon