Did you know that you can buy products from over 140 different suppliers from us?

MGC26647 (N-Term) antibody

Details for Product No. ABIN406540
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Epitope
N-Term
Reactivity
Cow (Bovine), Human
Host
Rabbit
(1)
Clonality
Polyclonal
Application
Western Blotting (WB)
(1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN406540
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human MGC26647
Sequence EEKQRLHLKKFLLDRMFLVAKIQANVERKDVADYYEQMFQ SVLKHHLGEA
Predicted Reactivity African malaria mosquito :100 %,   Human :100 %,   Bovine :70 %,  
Characteristics This is a rabbit polyclonal antibody against MGC26647. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Background The exact function of MGC26647 remains unknown.
Molecular Weight 29 kDa
Gene ID 219557
NCBI Accession NM_152706, NP_689919
UniProt Q8TBZ9
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 253 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-MGC26647 (N-Term) antibody WB Suggested Anti-MGC26647 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate
Background publications Scherer, Cheung, MacDonald et al.: "Human chromosome 7: DNA sequence and biology." in: Science (New York, N.Y.), Vol. 300, Issue 5620, pp. 767-72, 2003 (PubMed).

Validation Images
back to top