YTH Domain Family, Member 3 (YTHDF3) (N-Term) antibody

Details for Product No. ABIN406542
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 9130022A11Rik, wu:fi35c09, zgc:55441
Epitope
N-Term
(8), (6), (3), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Xenopus laevis, Dog (Canine), Cow (Bovine), Zebrafish (Danio rerio), Human, Chicken
(11), (1), (1), (1), (1), (1), (1), (1)
Host
Rabbit
(13)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(13), (7), (6), (2)
Pubmed 1 reference available
Catalog no. ABIN406542
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human YTHDF3
Sequence GEAAWSTAGDQPMPYLTTYGQMSNGEHHYIPDGVFSQPGA LGNTPPFLGQ
Predicted Reactivity African clawed frog : 100 %, Bovine : 100 %, Chicken : 100 %, Dog : 100 %, Human : 100 %, Mouse : 100 %, Rat : 100 %, Zebrafish : 90 %
Characteristics This is a rabbit polyclonal antibody against YTHDF3. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name YTHDF3
Background YTHDF3 contains 1 YTH domain. The functions of YTHDF3 remain unknown.
Molecular Weight 64 kDa
Gene ID 253943
NCBI Accession NM_152758, NP_689971
UniProt Q7Z739
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 585 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-YTH Domain Family, Member 3 (YTHDF3) (N-Term) antibody WB Suggested Anti-YTHDF3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Hela cell lysate
Product cited in: Mehrle, Rosenfelder, Schupp et al.: "The LIFEdb database in 2006." in: Nucleic acids research, Vol. 34, Issue Database issue, pp. D415-8, 2005 (PubMed).

Hosts (13)
Reactivities (11), (1), (1), (1), (1), (1), (1), (1)
Applications (13), (7), (6), (2)
Conjugates (1), (1), (1), (1), (1), (1)
Epitopes (8), (6), (3), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top