Did you know that you can buy products from over 140 different suppliers from us?

T-Complex 11, Testis-Specific-Like 2 (TCP11L2) (N-Term) antibody

Details for Product No. ABIN406544
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms E430026E19Rik, RGD1307494, wu:fc48b04, zgc:73347, TCP11
Epitope
N-Term
(7), (7), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Zebrafish (Danio rerio), Human, Chicken
(23)
Host
Rabbit
(14), (10)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(24), (9), (6), (6), (1), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN406544
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human TCP11L2
Sequence VHQAFWDVLDSELNADPPEFEHAIKLFEEIREILLSFLTP GGNRLRNQIC
Predicted Reactivity Dog : 100 %, Horse : 100 %, Human : 100 %, Pig : 100 %, Rabbit : 100 %, Chicken : 70 %
Characteristics This is a rabbit polyclonal antibody against TCP11L2. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name TCP11L2
Background The specific function of TCP11L2 is not yet known.
Molecular Weight 58 kDa
Gene ID 255394
NCBI Accession NM_152772, NP_689985
UniProt Q8N4U5
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 519 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-T-Complex 11, Testis-Specific-Like 2 (TCP11L2) (N-Term) antibody WB Suggested Anti-TCP11L2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human heart
Background publications Strausberg, Feingold, Grouse et al.: "Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 99, Issue 26, pp. 16899-903, 2002 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN406544
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top