Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN406544

T-Complex 11, Testis-Specific-Like 2 (TCP11L2) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms E430026E19Rik, RGD1307494, wu:fc48b04, zgc:73347, TCP11
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Zebrafish (Danio rerio), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN406544
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-TCP11L2 antibody: synthetic peptide directed towards the N terminal of human TCP11L2
Sequence VHQAFWDVLDSELNADPPEFEHAIKLFEEIREILLSFLTP GGNRLRNQIC
Predicted Reactivity Dog : 100%, Horse : 100%, Human : 100%, Pig : 100%, Rabbit : 100%, Chicken : 78%
Characteristics This is a rabbit polyclonal antibody against TCP11L2. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name TCP11L2
Background The specific function of TCP11L2 is not yet known.
Molecular Weight 58kDa
Gene ID 255394
NCBI Accession NP_689985, NM_152772
UniProt Q8N4U5
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-TCP11L2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Strausberg, Feingold, Grouse et al.: "Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 99, Issue 26, pp. 16899-903, 2002 (PubMed).

Alternatives for antigen "T-Complex 11, Testis-Specific-Like 2 (TCP11L2)", type "Antibodies"
Hosts (7), (5)
Reactivities (11)
Applications (12), (5), (3), (1), (1)
Epitopes (4), (2), (1)
Beacon