Hypothetical Protein FLJ37543 (FLJ37543) (N-Term) antibody

Details for Product No. ABIN406569
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Epitope
N-Term
(1)
Reactivity
Human
(1)
Host
Rabbit
(3)
Clonality
Polyclonal
Application
Western Blotting (WB)
(3)
Pubmed 1 reference available
Catalog no. ABIN406569
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human FLJ37543
Sequence MLAPLFLCCLRNLFRKLISFQPPQLGRTNMHYSKLPRTAI ETEFKQNVGP
Predicted Reactivity Human :100 %,  
Characteristics This is a rabbit polyclonal antibody against FLJ37543. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name FLJ37543
Background The exact functions of FLJ37543 remain unknown.
Molecular Weight 15 kDa
Gene ID 285668
NCBI Accession NM_173667, NP_775938
UniProt Q2M2E5
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 130 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Hypothetical Protein FLJ37543 (FLJ37543) (N-Term) antibody WB Suggested Anti-FLJ37543 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human heart
Background publications Ota, Suzuki, Nishikawa et al.: "Complete sequencing and characterization of 21,243 full-length human cDNAs." in: Nature genetics, Vol. 36, Issue 1, pp. 40-5, 2003 (PubMed).

Hosts (3)
Reactivities (1)
Applications (3)
Epitopes (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top