Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN406579

Angiopoietin-Like 5 (ANGPTL5) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ANGPTL5, bZ1P14.8, wu:fe36e01, si:rp71-1p14.8
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Cow (Bovine), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN406579
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ANGPTL5 antibody: synthetic peptide directed towards the N terminal of human ANGPTL5
Sequence ASLDYLSNQVNELMNRVLLLTTEVFRKQLDPFPHRPVQSH GLDCTDIKDT
Predicted Reactivity Horse : 100%, Bovine : 92%, Pig : 92%, Dog : 85%, Guinea pig : 85%
Characteristics This is a rabbit polyclonal antibody against ANGPTL5. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ANGPTL5
Background The exact functions of ANGPTL5 remain unknown.
Molecular Weight 44kDa
Gene ID 253935
NCBI Accession NP_835228, NM_178127
UniProt Q86XS5
Research Area Cardiovascular, Angiogenesis
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ANGPTL5 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Clark, Gurney, Abaya et al.: "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment." in: Genome research, Vol. 13, Issue 10, pp. 2265-70, 2003 (PubMed).

Alternatives for antigen "Angiopoietin-Like 5 (ANGPTL5)", type "Antibodies"
Hosts (22), (4)
Reactivities (24), (12), (12), (2), (1)
Applications (17), (10), (10), (3), (2), (2), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (4), (4), (1), (1)
Beacon