Angiopoietin-Like 5 (ANGPTL5) (N-Term) antibody

Details for Product No. ABIN406579
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ANGPTL5, bZ1P14.8, wu:fe36e01, si:rp71-1p14.8
Epitope
N-Term
(5), (4), (1), (1)
Reactivity
Cow (Bovine), Dog (Canine), Human
(26), (12), (12), (2), (1)
Host
Rabbit
(23), (5)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(19), (10), (8), (3), (3), (2), (2)
Pubmed 1 reference available
Catalog no. ABIN406579
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human ANGPTL5
Sequence ASLDYLSNQVNELMNRVLLLTTEVFRKQLDPFPHRPVQSH GLDCTDIKDT
Predicted Reactivity Horse : 100 %, Bovine : 90 %, Pig : 90 %, Dog : 80 %, Guinea pig : 80 %
Characteristics This is a rabbit polyclonal antibody against ANGPTL5. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ANGPTL5
Background The exact functions of ANGPTL5 remain unknown.
Molecular Weight 44 kDa
Gene ID 253935
NCBI Accession NM_178127, NP_835228
UniProt Q86XS5
Research Area Cardiovascular, Angiogenesis
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 388 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Angiopoietin-Like 5 (ANGPTL5) (N-Term) antibody WB Suggested Anti-ANGPTL5 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Hela cell lysate
Background publications Clark, Gurney, Abaya et al.: "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment...." in: Genome research, Vol. 13, Issue 10, pp. 2265-70, 2003 (PubMed).

Hosts (23), (5)
Reactivities (26), (12), (12), (2), (1)
Applications (19), (10), (8), (3), (3), (2), (2)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (5), (4), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top