Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN406592

MGC50273 (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Epitope
N-Term
Reactivity
Human
Host
Rabbit
Clonality Polyclonal
Application
Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN406592
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-MGC50273 antibody: synthetic peptide directed towards the N terminal of human MGC50273
Sequence MFVRPESGEQGPETLAPASGAEIQRFPVPAVEPVPAPGAD SPPGTALELE
Predicted Reactivity Human :100%,  
Characteristics This is a rabbit polyclonal antibody against MGC50273. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Background The specific function of the protein remains unknown.
Molecular Weight 22kDa
Gene ID 408029
NCBI Accession NP_999626, NM_214461
UniProt Q580R0-2
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-MGC50273 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Strausberg, Feingold, Grouse et al.: "Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 99, Issue 26, pp. 16899-903, 2002 (PubMed).

Beacon