Did you know that you can buy products from over 140 different suppliers from us?

Proteasome (Prosome, Macropain) Subunit, beta Type 2 (PSMB2) (Middle Region) antibody

Details for Product No. ABIN406608
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 19.m02268, DDBDRAFT_0190287, DDBDRAFT_0232958, DDB_0190287, DDB_0232958, Psmb2, ACYPI004276, AU045357, AW108089, C7-I, D4Wsu33e, HC7-I, zgc:92282
Epitope
Middle Region
(7), (3), (2), (2), (2), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human
(33), (6), (6), (1), (1), (1), (1)
Host
Rabbit
(25), (10)
Clonality
Polyclonal
Conjugate
Un-conjugated
(4), (4), (4), (1), (1), (1)
Application
Western Blotting (WB)
(25), (18), (13), (3), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN406608
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human PSMB2
Sequence YDEHEGPALYYMDYLAALAKAPFAAHGYGAFLTLSILDRY YTPTISRERA
Predicted Reactivity Dog : 100 %, Human : 100 %, Mouse : 100 %, Rabbit : 90 %, Chicken : 70 %
Characteristics This is a rabbit polyclonal antibody against PSMB2. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name PSMB2
Background The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits, 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. PSMB2 is a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit.The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits, 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit.
Molecular Weight 23 kDa
Gene ID 5690
NCBI Accession NM_002794, NP_002785
UniProt P49721
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 201 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Proteasome (Prosome, Macropain) Subunit, beta Type 2 (PSMB2) (Middle Region) antibody WB Suggested Anti-PSMB2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate
anti-Proteasome (Prosome, Macropain) Subunit, beta Type 2 (PSMB2) (Middle Region) antibody (2) Host: Rabbit
Target Name: PSMB2
Sample Tissue: 293T
Antibody Dilution: 1.0 µg/mL PSMB2 is supported by BioGPS gene expression data to be expressed in HEK293T
anti-Proteasome (Prosome, Macropain) Subunit, beta Type 2 (PSMB2) (Middle Region) antibody (3) Host: Rabbit
Target Name: PSMB2
Sample Tissue: Hela
Antibody Dilution: 1.0 µg/mL PSMB2 is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells
anti-Proteasome (Prosome, Macropain) Subunit, beta Type 2 (PSMB2) (Middle Region) antibody (4) Host: Rabbit
Target Name: PSMB2
Sample Tissue: Human Adult Placenta
Antibody Dilution: 1.0 µg/mL
Background publications Gregory, Barlow, McLay et al.: "The DNA sequence and biological annotation of human chromosome 1." in: Nature, Vol. 441, Issue 7091, pp. 315-21, 2006 (PubMed).

Validation Images
back to top