Ataxin 2-Binding Protein 1 (A2BP1) (Middle Region) antibody

Details for Product No. ABIN406670
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms A2bp1, 2BP1, A2BP1, FOX-1, FOX1, HRNBP1, A2bp, Hrnbp1, fox-1, fox1, a2bp1, zgc:103635
Epitope
Middle Region
(8), (1), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human
(23), (17), (16), (15), (12), (1)
Host
Rabbit
(24), (4)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(19), (10), (6), (5), (4), (4), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN406670
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human A2BP1
Sequence TAAAYSDRNQFVFVAADEISCNTSAVTDEFMLPTPTTTHL LQPPPTALVP
Predicted Reactivity Rat :100 %,   Dog :100 %,   Bovine :100 %,   Sumatran orangutan :100 %,   Crab-eating macaque :100 %,   Mouse :100 %,   Human :100 %,   Perigord truffle :90 %,   Caenorhabditis briggsae :70 %,  
Characteristics This is a rabbit polyclonal antibody against A2BP1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name A2BP1
Background Ataxin-2 binding protein 1(A2BP1) has an RNP motif that is highly conserved among RNA-binding proteins. This protein binds to the C-terminus of ataxin-2 and may contribute to the restricted pathology of spinocerebellar ataxia type 2 (SCA2). Ataxin-2 is the gene product of the SCA2 gene which causes familial neurodegenerative diseases. Ataxin-2 binding protein 1 and ataxin-2 are both localized in the trans-Golgi network. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene. Additional transcript variants have been found but their full length nature has not been determined.Ataxin-2 binding protein 1 has an RNP motif that is highly conserved among RNA-binding proteins. This protein binds to the C-terminus of ataxin-2 and may contribute to the restricted pathology of spinocerebellar ataxia type 2 (SCA2). Ataxin-2 is the gene product of the SCA2 gene which causes familial neurodegenerative diseases. Ataxin-2 binding protein 1 and ataxin-2 are both localized in the trans-Golgi network. Four alternatively spliced transcript variants have been found for this gene. Additional transcript variants have been found but their full length nature has not been determined.
Molecular Weight 42 kDa
Gene ID 54715
NCBI Accession NM_145893, NP_665900
UniProt Q9NWB1
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 395 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Ataxin 2-Binding Protein 1 (A2BP1) (Middle Region) antibody WB Suggested Anti-A2BP1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human brain
Background publications Uhl, Liu, Drgon et al.: "Molecular genetics of successful smoking cessation: convergent genome-wide association study results." in: Archives of general psychiatry, Vol. 65, Issue 6, pp. 683-93, 2008 (PubMed).

Hosts (24), (4)
Reactivities (23), (17), (16), (15), (12), (1)
Applications (19), (10), (6), (5), (4), (4), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (8), (1), (1), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top