Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN406714

Actin Related Protein 2/3 Complex, Subunit 2, 34kDa (ARPC2) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ARC34, PNAS-139, p34-Arc, 2210023N03Rik, 34kDa, fk84a07, wu:fa22f07, wu:fk84a07, zgc:77769, arc34, p34-arc, pnas-139, pro2446, Arpc2, Arc-p34
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Xenopus laevis, Pig (Porcine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN406714
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ARPC2 antibody: synthetic peptide directed towards the N terminal of human ARPC2
Sequence MVLNVYCCFFQISDIQTMKINQTILKEFILVGFSVYPHVQ TFLFVVFFCL
Predicted Reactivity African clawed frog : 100%, Bovine : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rat : 100%, Chicken : 92%, Horse : 85%
Characteristics This is a rabbit polyclonal antibody against ARPC2. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ARPC2
Background ARPC2 is one of seven subunits of the human Arp2/3 protein complex. The Arp2/3 protein complex has been implicated in the control of actin polymerization in cells and has been conserved through evolution. The exact role of ARPC2, the p34 subunit, has yet to be determined. This gene encodes one of seven subunits of the human Arp2/3 protein complex. The Arp2/3 protein complex has been implicated in the control of actin polymerization in cells and has been conserved through evolution. The exact role of the protein encoded by this gene, the p34 subunit, has yet to be determined. Two alternatively spliced variants have been characterized to date. Additional alternatively spliced variants have been described but their full length nature has not been determined.
Molecular Weight 33kDa
Gene ID 10109
NCBI Accession NP_005722, NM_005731
UniProt O15144
Research Area Signaling, Cytoskeleton, Microfilaments
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ARPC2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Cai, Marshall, Uetrecht et al.: "Coronin 1B coordinates Arp2/3 complex and cofilin activities at the leading edge." in: Cell, Vol. 128, Issue 5, pp. 915-29, 2007 (PubMed).

Alternatives for antigen "Actin Related Protein 2/3 Complex, Subunit 2, 34kDa (ARPC2)", type "Antibodies"
Hosts (30), (12), (3)
Reactivities (41), (23), (22), (16), (15), (13), (2), (1)
Applications (34), (23), (15), (10), (9), (5), (4)
Conjugates (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (10), (3), (1), (1), (1), (1), (1)
Beacon