WD Repeat Domain 3 (WDR3) (Middle Region) antibody

Details for Product No. ABIN406737
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms DIP2, UTP12, AW546279, D030020G18Rik, sb:cb42, wu:fb92b07, MGC76073
Epitope
Middle Region
(3), (2), (2), (1)
Reactivity
Rat (Rattus), Cow (Bovine), Xenopus laevis, Zebrafish (Danio rerio), Human, Chicken
(6)
Host
Rabbit
(6)
Clonality
Polyclonal
Application
Western Blotting (WB)
(6), (3), (1)
Pubmed 1 reference available
Catalog no. ABIN406737
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human WDR3
Sequence VIGFNMAGLDYLKRECEAKSEVMFFADATSHLEEKKRKRK KREKLILTLT
Predicted Reactivity Bovine : 100 %, Horse : 100 %, Human : 100 %, Pig : 100 %, Rabbit : 100 %, Guinea pig : 90 %, African clawed frog : 90 %, Chicken : 80 %, Rat : 80 %, Zebrafish : 70 %
Characteristics This is a rabbit polyclonal antibody against WDR3. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name WDR3
Background WDR3 is a nuclear protein containing 10 WD repeats. WD repeats are approximately 30- to 40-amino acid domains containing several conserved residues, which usually include a trp-asp at the C-terminal end. Proteins belonging to the WD repeat family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation.This gene encodes a nuclear protein containing 10 WD repeats. WD repeats are approximately 30- to 40-amino acid domains containing several conserved residues, which usually include a trp-asp at the C-terminal end. Proteins belonging to the WD repeat family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation.
Molecular Weight 106 kDa
Gene ID 10885
NCBI Accession NM_006784, NP_006775
UniProt Q9UNX4
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 943 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-WD Repeat Domain 3 (WDR3) (Middle Region) antibody WB Suggested Anti-WDR3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Hela cell lysate
Background publications Nousiainen, Silljé, Sauer et al.: "Phosphoproteome analysis of the human mitotic spindle." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 103, Issue 14, pp. 5391-6, 2006 (PubMed).

Hosts (6)
Reactivities (6)
Applications (6), (3), (1)
Epitopes (3), (2), (2), (1)
back to top