Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN406737

WD Repeat Domain 3 (WDR3) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms DIP2, UTP12, AW546279, D030020G18Rik, sb:cb42, wu:fb92b07, MGC76073
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Rat (Rattus), Cow (Bovine), Xenopus laevis, Zebrafish (Danio rerio), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN406737
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-WDR3 antibody: synthetic peptide directed towards the middle region of human WDR3
Sequence VIGFNMAGLDYLKRECEAKSEVMFFADATSHLEEKKRKRK KREKLILTLT
Predicted Reactivity Bovine : 100%, Horse : 100%, Human : 100%, Pig : 100%, Rabbit : 100%, Guinea pig : 93%, African clawed frog : 92%, Chicken : 85%, Rat : 80%, Zebrafish : 78%
Characteristics This is a rabbit polyclonal antibody against WDR3. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name WDR3
Background WDR3 is a nuclear protein containing 10 WD repeats. WD repeats are approximately 30- to 40-amino acid domains containing several conserved residues, which usually include a trp-asp at the C-terminal end. Proteins belonging to the WD repeat family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation.This gene encodes a nuclear protein containing 10 WD repeats. WD repeats are approximately 30- to 40-amino acid domains containing several conserved residues, which usually include a trp-asp at the C-terminal end. Proteins belonging to the WD repeat family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation.
Molecular Weight 106kDa
Gene ID 10885
NCBI Accession NP_006775, NM_006784
UniProt Q9UNX4
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-WDR3 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Nousiainen, Silljé, Sauer et al.: "Phosphoproteome analysis of the human mitotic spindle." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 103, Issue 14, pp. 5391-6, 2006 (PubMed).

Alternatives for antigen "WD Repeat Domain 3 (WDR3)", type "Antibodies"
Hosts (7)
Reactivities (7)
Applications (7), (3), (2), (1)
Epitopes (4), (2), (2), (1)
Beacon